Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacT-ataR/DUF1778(antitoxin)
Location 815790..816570 Replicon chromosome
Accession NZ_HG938355
Organism Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141

Toxin (Protein)


Gene name tacT Uniprot ID A0A068T556
Locus tag RG1141_RS04275 Protein ID WP_038541294.1
Coordinates 816070..816570 (+) Length 167 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID -
Locus tag RG1141_RS04270 Protein ID WP_157885088.1
Coordinates 815790..816065 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG1141_RS04230 811255..811515 + 261 WP_038541274.1 ribbon-helix-helix protein, CopG family -
RG1141_RS31955 811667..811819 + 153 WP_162182329.1 hypothetical protein -
RG1141_RS04240 812043..812378 + 336 WP_038541277.1 hypothetical protein -
RG1141_RS04245 812429..813010 + 582 WP_038541279.1 HK97 family phage prohead protease -
RG1141_RS04250 813007..814287 + 1281 WP_038541281.1 phage major capsid protein -
RG1141_RS04255 814425..814994 + 570 WP_038541284.1 head-tail connector protein -
RG1141_RS04260 814994..815326 + 333 WP_038541285.1 phage head closure protein -
RG1141_RS04265 815323..815721 + 399 WP_038541288.1 DUF3168 domain-containing protein -
RG1141_RS04270 815790..816065 + 276 WP_157885088.1 DUF1778 domain-containing protein Antitoxin
RG1141_RS04275 816070..816570 + 501 WP_038541294.1 GNAT family N-acetyltransferase Toxin
RG1141_RS04280 816532..817791 - 1260 WP_080719134.1 MFS transporter -
RG1141_RS04285 817883..818290 + 408 WP_038541300.1 phage major tail protein, TP901-1 family -
RG1141_RS04290 818290..818637 + 348 WP_038541305.1 gene transfer agent family protein -
RG1141_RS31280 818742..818900 + 159 WP_080719135.1 phage tail assembly chaperone -
RG1141_RS04300 819144..819674 + 531 WP_038541308.1 phage tail tape measure protein -
RG1141_RS04305 819696..820334 + 639 WP_038541310.1 DUF2460 domain-containing protein -
RG1141_RS04310 820331..821206 + 876 WP_038541313.1 DUF2163 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 800872..825831 24959


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(31-146)

Antitoxin

Vibrio phage ICP1, Orf50

(10-85)


Sequences

Toxin        


Download         Length: 167 a.a.        Molecular weight: 18350.26 Da        Isoelectric Point: 9.7100

>T285159 WP_038541294.1 NZ_HG938355:816070-816570 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MYRKPAPLSEQHHLGEFDSGKPVLDVFLKEMALHNQVQGYTRTFVIADADFRVVGYHSLCAGMISREKAPRHVKGHQAPG
EIPVALLARLAVDRRHHGQGLGGELLKNALLAVVATSEVVAFRAVMVHALDDEATRFYLRYGFRQAKGLDRTLLLPVKDI
LASISS

Download         Length: 501 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 9964.39 Da        Isoelectric Point: 4.4692

>AT285159 WP_157885088.1 NZ_HG938355:815790-816065 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MVALRKSETINLRIDAGTRDVIARAAEISGKSLTAFMTEAAFAVAQKELLDQRFIGVDATVFDAVEDLLGEPAQVNEKLS
ALLKSNREWLD

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068T556

Antitoxin

Source ID Structure

References