Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 358530..359176 | Replicon | chromosome |
Accession | NZ_FO834906 | ||
Organism | Klebsiella pneumoniae strain Kp52.145 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | BN49_RS02820 | Protein ID | WP_016529833.1 |
Coordinates | 358530..358877 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W9BB18 |
Locus tag | BN49_RS02825 | Protein ID | WP_016529832.1 |
Coordinates | 358877..359176 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN49_RS02810 | 354456..355889 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
BN49_RS02815 | 355907..358354 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
BN49_RS02820 | 358530..358877 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN49_RS02825 | 358877..359176 | + | 300 | WP_016529832.1 | helix-turn-helix domain-containing protein | Antitoxin |
BN49_RS02830 | 359239..360747 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
BN49_RS02835 | 360952..361281 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
BN49_RS02840 | 361332..362162 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
BN49_RS02845 | 362212..362970 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T284927 WP_016529833.1 NZ_FO834906:358530-358877 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|