Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 69571..70214 | Replicon | plasmid I |
Accession | NZ_FO834904 | ||
Organism | Klebsiella pneumoniae strain Kp52.145 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | BN49_RS00410 | Protein ID | WP_001044768.1 |
Coordinates | 69571..69987 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | BN49_RS00415 | Protein ID | WP_001261287.1 |
Coordinates | 69984..70214 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN49_RS00375 | 64665..64919 | - | 255 | WP_016528790.1 | hypothetical protein | - |
BN49_RS00380 | 64995..65252 | - | 258 | WP_004098928.1 | hypothetical protein | - |
BN49_RS00385 | 65301..65504 | - | 204 | WP_004150739.1 | hemolysin expression modulator Hha | - |
BN49_RS00390 | 65565..66059 | - | 495 | WP_016528789.1 | hypothetical protein | - |
BN49_RS00395 | 66090..66656 | - | 567 | WP_009654312.1 | hypothetical protein | - |
BN49_RS00400 | 66653..66916 | - | 264 | WP_009310051.1 | hypothetical protein | - |
BN49_RS00405 | 67271..69409 | + | 2139 | WP_000350635.1 | AAA family ATPase | - |
BN49_RS00410 | 69571..69987 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BN49_RS00415 | 69984..70214 | - | 231 | WP_001261287.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
BN49_RS00420 | 70520..73639 | + | 3120 | WP_032446663.1 | hypothetical protein | - |
BN49_RS00425 | 73902..75035 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | clbI / basG | 1..95087 | 95087 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T284920 WP_001044768.1 NZ_FO834904:c69987-69571 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |