Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 4053494..4054377 | Replicon | chromosome |
| Accession | NZ_CP128540 | ||
| Organism | Pseudomonas alloputida strain NMI24_14 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | Q88K57 |
| Locus tag | LU682_RS18810 | Protein ID | WP_003250527.1 |
| Coordinates | 4053494..4053931 (-) | Length | 146 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | I7C3Q7 |
| Locus tag | LU682_RS18815 | Protein ID | WP_003250525.1 |
| Coordinates | 4053928..4054377 (-) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU682_RS18785 (LU682_018785) | 4049038..4049427 | - | 390 | WP_049587628.1 | hypothetical protein | - |
| LU682_RS18790 (LU682_018790) | 4049430..4049678 | - | 249 | Protein_3700 | PAAR domain-containing protein | - |
| LU682_RS18795 (LU682_018795) | 4049842..4051071 | - | 1230 | WP_049587623.1 | acyl-CoA dehydrogenase | - |
| LU682_RS18800 (LU682_018800) | 4051212..4052138 | + | 927 | WP_010953387.1 | LysR family transcriptional regulator | - |
| LU682_RS18805 (LU682_018805) | 4052332..4053486 | + | 1155 | WP_049587669.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
| LU682_RS18810 (LU682_018810) | 4053494..4053931 | - | 438 | WP_003250527.1 | RES family NAD+ phosphorylase | Toxin |
| LU682_RS18815 (LU682_018815) | 4053928..4054377 | - | 450 | WP_003250525.1 | DUF2384 domain-containing protein | Antitoxin |
| LU682_RS18820 (LU682_018820) | 4054520..4055173 | - | 654 | WP_010953384.1 | oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB | - |
| LU682_RS18825 (LU682_018825) | 4055277..4056200 | + | 924 | WP_010953383.1 | LysR family transcriptional regulator | - |
| LU682_RS18830 (LU682_018830) | 4056249..4057079 | + | 831 | WP_003250518.1 | AraC family transcriptional regulator | - |
| LU682_RS18835 (LU682_018835) | 4057130..4057714 | + | 585 | WP_010953382.1 | LysE family transporter | - |
| LU682_RS18840 (LU682_018840) | 4057754..4058953 | - | 1200 | WP_049587621.1 | sugar transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15990.29 Da Isoelectric Point: 5.6007
>T284835 WP_003250527.1 NZ_CP128540:c4053931-4053494 [Pseudomonas alloputida]
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQ
PGWSAQPELTRTLGNRFLDDCSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQ
PGWSAQPELTRTLGNRFLDDCSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
Download Length: 438 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16956.46 Da Isoelectric Point: 5.7258
>AT284835 WP_003250525.1 NZ_CP128540:c4054377-4053928 [Pseudomonas alloputida]
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|