Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 244858..245494 | Replicon | chromosome |
| Accession | NZ_CP128459 | ||
| Organism | Geobacillus stearothermophilus strain EF60134 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | L7ZVP1 |
| Locus tag | QT238_RS01280 | Protein ID | WP_003253417.1 |
| Coordinates | 245144..245494 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A087LE06 |
| Locus tag | QT238_RS01275 | Protein ID | WP_033010302.1 |
| Coordinates | 244858..245139 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QT238_RS01255 (QT238_01255) | 241109..241726 | - | 618 | WP_289668350.1 | rhomboid family intramembrane serine protease | - |
| QT238_RS01260 (QT238_01260) | 241846..242235 | + | 390 | WP_033010299.1 | holo-ACP synthase | - |
| QT238_RS01265 (QT238_01265) | 242315..243334 | + | 1020 | WP_277391990.1 | outer membrane lipoprotein carrier protein LolA | - |
| QT238_RS01270 (QT238_01270) | 243577..244743 | + | 1167 | WP_033010307.1 | alanine racemase | - |
| QT238_RS01275 (QT238_01275) | 244858..245139 | + | 282 | WP_033010302.1 | hypothetical protein | Antitoxin |
| QT238_RS01280 (QT238_01280) | 245144..245494 | + | 351 | WP_003253417.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QT238_RS01285 (QT238_01285) | 246037..248199 | + | 2163 | WP_289668351.1 | Tex family protein | - |
| QT238_RS01290 (QT238_01290) | 248257..248370 | - | 114 | WP_094239478.1 | cortex morphogenetic protein CmpA | - |
| QT238_RS01295 (QT238_01295) | 248464..248925 | + | 462 | WP_033016555.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12992.00 Da Isoelectric Point: 4.8781
>T284579 WP_003253417.1 NZ_CP128459:245144-245494 [Geobacillus stearothermophilus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9ERQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A087LE06 |