Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 231602..232238 | Replicon | chromosome |
Accession | NZ_CP128453 | ||
Organism | Geobacillus stearothermophilus strain EF60045 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | L7ZVP1 |
Locus tag | QT235_RS01255 | Protein ID | WP_003253417.1 |
Coordinates | 231888..232238 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A087LE06 |
Locus tag | QT235_RS01250 | Protein ID | WP_033010302.1 |
Coordinates | 231602..231883 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QT235_RS01230 (QT235_01230) | 227854..228471 | - | 618 | WP_289643528.1 | rhomboid family intramembrane serine protease | - |
QT235_RS01235 (QT235_01235) | 228590..228979 | + | 390 | WP_289643530.1 | holo-ACP synthase | - |
QT235_RS01240 (QT235_01240) | 229059..230078 | + | 1020 | WP_289643531.1 | outer membrane lipoprotein carrier protein LolA | - |
QT235_RS01245 (QT235_01245) | 230321..231487 | + | 1167 | WP_033010307.1 | alanine racemase | - |
QT235_RS01250 (QT235_01250) | 231602..231883 | + | 282 | WP_033010302.1 | hypothetical protein | Antitoxin |
QT235_RS01255 (QT235_01255) | 231888..232238 | + | 351 | WP_003253417.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QT235_RS01260 (QT235_01260) | 232782..234944 | + | 2163 | WP_033010303.1 | Tex family protein | - |
QT235_RS01265 (QT235_01265) | 235002..235115 | - | 114 | WP_089135018.1 | cortex morphogenetic protein CmpA | - |
QT235_RS01270 (QT235_01270) | 235207..235668 | + | 462 | WP_033010304.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12992.00 Da Isoelectric Point: 4.8781
>T284572 WP_003253417.1 NZ_CP128453:231888-232238 [Geobacillus stearothermophilus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9ERQ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A087LE06 |