Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 45560..45829 | Replicon | plasmid pT309.Ta3_2 |
| Accession | NZ_CP128257 | ||
| Organism | Escherichia coli strain T309.Ta3 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QRX22_RS26260 | Protein ID | WP_001372321.1 |
| Coordinates | 45704..45829 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 45560..45625 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRX22_RS26220 (40578) | 40578..41027 | - | 450 | Protein_45 | hypothetical protein | - |
| QRX22_RS26225 (41329) | 41329..41856 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| QRX22_RS26230 (41914) | 41914..42147 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| QRX22_RS26235 (42208) | 42208..44172 | + | 1965 | WP_000117316.1 | ParB/RepB/Spo0J family partition protein | - |
| QRX22_RS26240 (44241) | 44241..44675 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| QRX22_RS26245 (44672) | 44672..45434 | + | 763 | Protein_50 | plasmid SOS inhibition protein A | - |
| QRX22_RS26250 (45412) | 45412..45591 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - (45560) | 45560..45625 | + | 66 | NuclAT_1 | - | - |
| - (45560) | 45560..45625 | - | 66 | NuclAT_0 | - | Antitoxin |
| - (45403) | 45403..45627 | + | 225 | NuclAT_0 | - | - |
| - (45403) | 45403..45627 | + | 225 | NuclAT_0 | - | - |
| - (45403) | 45403..45627 | + | 225 | NuclAT_0 | - | - |
| - (45403) | 45403..45627 | + | 225 | NuclAT_0 | - | - |
| - (45406) | 45406..45627 | - | 222 | NuclAT_0 | - | - |
| QRX22_RS26255 (45613) | 45613..45762 | + | 150 | Protein_52 | plasmid maintenance protein Mok | - |
| QRX22_RS26260 (45704) | 45704..45829 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QRX22_RS26265 (46148) | 46148..46445 | - | 298 | Protein_54 | hypothetical protein | - |
| QRX22_RS26270 (46745) | 46745..47041 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| QRX22_RS26275 (47152) | 47152..47973 | + | 822 | WP_021549731.1 | DUF932 domain-containing protein | - |
| QRX22_RS26280 (48270) | 48270..48779 | - | 510 | WP_000759173.1 | transglycosylase SLT domain-containing protein | - |
| QRX22_RS26285 (49193) | 49193..49576 | + | 384 | WP_001151538.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QRX22_RS26290 (49763) | 49763..50452 | + | 690 | WP_016239105.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T284481 WP_001372321.1 NZ_CP128257:45704-45829 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT284481 NZ_CP128257:c45625-45560 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
