Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
| Location | 4416183..4416592 | Replicon | chromosome |
| Accession | NZ_CP128255 | ||
| Organism | Escherichia coli strain T309.Ta3 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | A0A3L4RJH9 |
| Locus tag | QRX22_RS21645 | Protein ID | WP_001357525.1 |
| Coordinates | 4416254..4416592 (+) | Length | 113 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4416183..4416259 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRX22_RS21610 (4412185) | 4412185..4412388 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| QRX22_RS21615 (4412399) | 4412399..4413355 | + | 957 | WP_001314406.1 | GTPase | - |
| QRX22_RS21620 (4413389) | 4413389..4413691 | - | 303 | WP_000063161.1 | BrnA antitoxin family protein | - |
| QRX22_RS21625 (4413706) | 4413706..4413807 | - | 102 | Protein_4239 | hypothetical protein | - |
| QRX22_RS21630 (4413993) | 4413993..4415159 | + | 1167 | WP_000800830.1 | restriction endonuclease | - |
| QRX22_RS21635 (4415204) | 4415204..4415377 | + | 174 | Protein_4241 | type I restriction-modification system subunit M N-terminal domain-containing protein | - |
| QRX22_RS21640 (4415371) | 4415371..4416039 | + | 669 | Protein_4242 | DUF3387 domain-containing protein | - |
| - (4416183) | 4416183..4416259 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4416183) | 4416183..4416259 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4416183) | 4416183..4416259 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4416183) | 4416183..4416259 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4416183) | 4416183..4416259 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4416183) | 4416183..4416259 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4416183) | 4416183..4416259 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4416183) | 4416183..4416259 | - | 77 | NuclAT_6 | - | Antitoxin |
| QRX22_RS21645 (4416254) | 4416254..4416592 | + | 339 | WP_001357525.1 | endoribonuclease SymE | Toxin |
| QRX22_RS21650 (4416680) | 4416680..4416814 | - | 135 | WP_230158887.1 | hypothetical protein | - |
| QRX22_RS21655 (4416976) | 4416976..4417290 | + | 315 | Protein_4245 | winged helix-turn-helix domain-containing protein | - |
| QRX22_RS21660 (4417282) | 4417282..4418202 | - | 921 | WP_021531000.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| QRX22_RS21665 (4418387) | 4418387..4419667 | + | 1281 | WP_001535800.1 | DUF445 domain-containing protein | - |
| QRX22_RS21670 (4419783) | 4419783..4420934 | + | 1152 | WP_001298064.1 | double-cubane-cluster-containing anaerobic reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12314.03 Da Isoelectric Point: 7.8234
>T284474 WP_001357525.1 NZ_CP128255:4416254-4416592 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFTTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQRQVQDFIGVISSKTPR
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFTTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQRQVQDFIGVISSKTPR
Download Length: 339 bp
Antitoxin
Download Length: 77 bp
>AT284474 NZ_CP128255:c4416259-4416183 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
