Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4302746..4303296 Replicon chromosome
Accession NZ_CP128255
Organism Escherichia coli strain T309.Ta3

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QRX22_RS21065 Protein ID WP_001160966.1
Coordinates 4302746..4303060 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QRX22_RS21070 Protein ID WP_000125566.1
Coordinates 4303063..4303296 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRX22_RS21040 (4298421) 4298421..4299707 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QRX22_RS21045 (4299707) 4299707..4300696 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QRX22_RS21050 (4300693) 4300693..4301514 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QRX22_RS21055 (4301517) 4301517..4301894 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QRX22_RS21060 (4301901) 4301901..4302749 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QRX22_RS21065 (4302746) 4302746..4303060 - 315 WP_001160966.1 CcdB family protein Toxin
QRX22_RS21070 (4303063) 4303063..4303296 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QRX22_RS21075 (4303382) 4303382..4303861 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QRX22_RS21080 (4304053) 4304053..4305915 - 1863 WP_033559426.1 glutathione-regulated potassium-efflux system protein KefC -
QRX22_RS21085 (4305908) 4305908..4306438 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QRX22_RS21090 (4306546) 4306546..4307877 - 1332 WP_001183208.1 MFS transporter -
QRX22_RS21095 (4307936) 4307936..4308223 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T284473 WP_001160966.1 NZ_CP128255:c4303060-4302746 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT284473 WP_000125566.1 NZ_CP128255:c4303296-4303063 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References