Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 195373..195595 | Replicon | chromosome |
| Accession | NZ_CP128255 | ||
| Organism | Escherichia coli strain T309.Ta3 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | QRX22_RS00945 | Protein ID | WP_001295224.1 |
| Coordinates | 195488..195595 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 195373..195431 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRX22_RS00925 | 190814..191716 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| QRX22_RS00930 | 191727..192710 | + | 984 | WP_021531678.1 | dipeptide ABC transporter ATP-binding protein | - |
| QRX22_RS00935 | 192707..193711 | + | 1005 | WP_000103570.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| QRX22_RS00940 | 193741..195012 | - | 1272 | WP_014640225.1 | aromatic amino acid transport family protein | - |
| - | 195373..195431 | - | 59 | - | - | Antitoxin |
| QRX22_RS00945 | 195488..195595 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| QRX22_RS00950 | 195682..197361 | - | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| QRX22_RS00955 | 197358..197549 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| QRX22_RS00960 | 197546..199117 | - | 1572 | WP_001204945.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| QRX22_RS00965 | 199390..199578 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
| QRX22_RS00970 | 199590..200342 | + | 753 | Protein_191 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T284459 WP_001295224.1 NZ_CP128255:195488-195595 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 59 bp
>AT284459 NZ_CP128255:c195431-195373 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|