Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-YefM |
| Location | 56770..57332 | Replicon | plasmid pVFBJ05 |
| Accession | NZ_CP128206 | ||
| Organism | Vibrio furnissii strain VFBJ05 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QSU95_RS23435 | Protein ID | WP_038152854.1 |
| Coordinates | 57030..57332 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | QSU95_RS23430 | Protein ID | WP_004729600.1 |
| Coordinates | 56770..57015 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSU95_RS23415 (QSU95_23415) | 54355..54582 | - | 228 | WP_038152853.1 | hypothetical protein | - |
| QSU95_RS23420 (QSU95_23420) | 54812..55732 | + | 921 | WP_202644000.1 | IS5 family transposase | - |
| QSU95_RS23425 (QSU95_23425) | 56033..56569 | - | 537 | Protein_51 | recombinase family protein | - |
| QSU95_RS23430 (QSU95_23430) | 56770..57015 | + | 246 | WP_004729600.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QSU95_RS23435 (QSU95_23435) | 57030..57332 | + | 303 | WP_038152854.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QSU95_RS23440 (QSU95_23440) | 57329..57931 | - | 603 | WP_004729602.1 | recombinase family protein | - |
| QSU95_RS23445 (QSU95_23445) | 58541..59617 | - | 1077 | WP_038152856.1 | replication initiation protein | - |
| QSU95_RS23450 (QSU95_23450) | 60561..61283 | + | 723 | WP_004729604.1 | hypothetical protein | - |
| QSU95_RS23455 (QSU95_23455) | 61273..62022 | + | 750 | WP_119299138.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | - | 1..85626 | 85626 | |
| - | flank | IS/Tn | - | - | 54812..55732 | 920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11644.32 Da Isoelectric Point: 6.7572
>T284406 WP_038152854.1 NZ_CP128206:57030-57332 [Vibrio furnissii]
MSSYKLSPLAQSDLTDIRRYTIEHWGSTQWSVYFNELQESMSLLASNELIGIQIPEMGERYYRFPLKHHVIYYITQEDHI
VIVAVLGKHMSPAKHFASIS
MSSYKLSPLAQSDLTDIRRYTIEHWGSTQWSVYFNELQESMSLLASNELIGIQIPEMGERYYRFPLKHHVIYYITQEDHI
VIVAVLGKHMSPAKHFASIS
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|