Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 104618..105153 | Replicon | plasmid pELP1.10 |
Accession | NZ_CP127882 | ||
Organism | Serratia marcescens strain ELP1.10 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QRD25_RS24370 | Protein ID | WP_164058116.1 |
Coordinates | 104618..104905 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QRD25_RS24375 | Protein ID | WP_164058115.1 |
Coordinates | 104902..105153 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD25_RS24340 (QRD25_24350) | 100082..100482 | - | 401 | Protein_86 | transposase | - |
QRD25_RS24345 (QRD25_24355) | 100571..100774 | + | 204 | Protein_87 | hypothetical protein | - |
QRD25_RS24350 (QRD25_24360) | 100910..101056 | + | 147 | Protein_88 | DNA polymerase V subunit UmuC | - |
QRD25_RS24355 (QRD25_24365) | 101647..102426 | + | 780 | WP_286094250.1 | hypothetical protein | - |
QRD25_RS24360 (QRD25_24370) | 102700..103032 | - | 333 | WP_286094251.1 | hypothetical protein | - |
QRD25_RS24365 (QRD25_24375) | 103123..103527 | - | 405 | WP_286094252.1 | hypothetical protein | - |
QRD25_RS24370 (QRD25_24380) | 104618..104905 | - | 288 | WP_164058116.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRD25_RS24375 (QRD25_24385) | 104902..105153 | - | 252 | WP_164058115.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QRD25_RS24380 (QRD25_24390) | 105268..105945 | - | 678 | Protein_94 | plasmid SOS inhibition protein A | - |
QRD25_RS24385 (QRD25_24395) | 105990..106430 | - | 441 | WP_286094253.1 | conjugation system SOS inhibitor PsiB | - |
QRD25_RS24390 (QRD25_24400) | 106473..108524 | - | 2052 | WP_286094254.1 | ParB N-terminal domain-containing protein | - |
QRD25_RS24395 (QRD25_24405) | 108618..108908 | - | 291 | WP_197761722.1 | ribulokinase | - |
QRD25_RS24400 (QRD25_24410) | 109450..110085 | + | 636 | WP_019454356.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..129237 | 129237 | |
- | flank | IS/Tn | - | - | 100082..100354 | 272 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10887.98 Da Isoelectric Point: 10.2278
>T284345 WP_164058116.1 NZ_CP127882:c104905-104618 [Serratia marcescens]
VMYTIKFRESALKEWGKLDKALQQQFAKKLKKCCENPHIPSAKLRGMPGCYKIKLRASGFRLVYEVIDDCLIIAVVAVGK
RERGDVYQLASERLK
VMYTIKFRESALKEWGKLDKALQQQFAKKLKKCCENPHIPSAKLRGMPGCYKIKLRASGFRLVYEVIDDCLIIAVVAVGK
RERGDVYQLASERLK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|