Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4068301..4068953 | Replicon | chromosome |
| Accession | NZ_CP127881 | ||
| Organism | Serratia marcescens strain ELP1.10 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QRD25_RS19380 | Protein ID | WP_004931830.1 |
| Coordinates | 4068301..4068645 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A086GAN0 |
| Locus tag | QRD25_RS19385 | Protein ID | WP_004931828.1 |
| Coordinates | 4068651..4068953 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD25_RS19370 (QRD25_19375) | 4064643..4066901 | - | 2259 | WP_286093559.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
| QRD25_RS19375 (QRD25_19380) | 4067122..4068141 | + | 1020 | WP_004931832.1 | HTH-type transcriptional regulator GalR | - |
| QRD25_RS19380 (QRD25_19385) | 4068301..4068645 | + | 345 | WP_004931830.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRD25_RS19385 (QRD25_19390) | 4068651..4068953 | + | 303 | WP_004931828.1 | XRE family transcriptional regulator | Antitoxin |
| QRD25_RS19390 (QRD25_19395) | 4068981..4070243 | - | 1263 | WP_021505676.1 | diaminopimelate decarboxylase | - |
| QRD25_RS19395 (QRD25_19400) | 4070377..4071300 | + | 924 | WP_286093560.1 | LysR family transcriptional regulator | - |
| QRD25_RS19400 (QRD25_19405) | 4071328..4072236 | - | 909 | WP_015378928.1 | LysR family transcriptional regulator | - |
| QRD25_RS19405 (QRD25_19410) | 4072345..4073229 | + | 885 | WP_004931820.1 | MBL fold metallo-hydrolase | - |
| QRD25_RS19410 (QRD25_19415) | 4073304..4073951 | + | 648 | WP_004931818.1 | DsbA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13383.44 Da Isoelectric Point: 10.6087
>T284342 WP_004931830.1 NZ_CP127881:4068301-4068645 [Serratia marcescens]
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|