Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 19551..20152 | Replicon | chromosome |
| Accession | NZ_CP127881 | ||
| Organism | Serratia marcescens strain ELP1.10 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A0P0Q8I8 |
| Locus tag | QRD25_RS00100 | Protein ID | WP_004933929.1 |
| Coordinates | 19551..19931 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A086G6A0 |
| Locus tag | QRD25_RS00105 | Protein ID | WP_004933932.1 |
| Coordinates | 19931..20152 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD25_RS00075 (QRD25_00075) | 14797..16077 | + | 1281 | WP_004933910.1 | DUF3748 domain-containing protein | - |
| QRD25_RS00080 (QRD25_00080) | 16108..16455 | - | 348 | WP_004933911.1 | YceK/YidQ family lipoprotein | - |
| QRD25_RS00085 (QRD25_00085) | 16765..17178 | + | 414 | WP_004933919.1 | small heat shock chaperone IbpA | - |
| QRD25_RS00090 (QRD25_00090) | 17286..17714 | + | 429 | WP_004933922.1 | small heat shock chaperone IbpB | - |
| QRD25_RS00095 (QRD25_00095) | 17882..19540 | + | 1659 | WP_131165267.1 | putative transporter | - |
| QRD25_RS00100 (QRD25_00100) | 19551..19931 | - | 381 | WP_004933929.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRD25_RS00105 (QRD25_00105) | 19931..20152 | - | 222 | WP_004933932.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| QRD25_RS00110 (QRD25_00110) | 20227..21477 | - | 1251 | WP_004933935.1 | valine--pyruvate transaminase | - |
| QRD25_RS00115 (QRD25_00115) | 21613..23676 | - | 2064 | WP_286093686.1 | alpha-amylase | - |
| QRD25_RS00120 (QRD25_00120) | 23872..24024 | + | 153 | WP_015376155.1 | hypothetical protein | - |
| QRD25_RS00125 (QRD25_00125) | 24026..25003 | - | 978 | WP_197753766.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14173.48 Da Isoelectric Point: 7.3170
>T284331 WP_004933929.1 NZ_CP127881:c19931-19551 [Serratia marcescens]
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHTNPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHTNPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P0Q8I8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086G6A0 |