Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 856328..856985 | Replicon | chromosome |
Accession | NZ_CP127873 | ||
Organism | Klebsiella michiganensis strain ELP1.34B |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A6P1V2U3 |
Locus tag | QRD21_RS04095 | Protein ID | WP_046876661.1 |
Coordinates | 856575..856985 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | H3N295 |
Locus tag | QRD21_RS04090 | Protein ID | WP_004124953.1 |
Coordinates | 856328..856594 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD21_RS04075 (QRD21_04075) | 851562..851987 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
QRD21_RS04080 (QRD21_04080) | 852108..854906 | - | 2799 | WP_286115458.1 | transcriptional regulator DagR | - |
QRD21_RS04085 (QRD21_04085) | 855100..856083 | - | 984 | WP_014226793.1 | tRNA-modifying protein YgfZ | - |
QRD21_RS04090 (QRD21_04090) | 856328..856594 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
QRD21_RS04095 (QRD21_04095) | 856575..856985 | + | 411 | WP_046876661.1 | protein YgfX | Toxin |
QRD21_RS04100 (QRD21_04100) | 856994..857515 | - | 522 | WP_014226792.1 | flavodoxin FldB | - |
QRD21_RS04105 (QRD21_04105) | 857637..858533 | + | 897 | WP_046876662.1 | site-specific tyrosine recombinase XerD | - |
QRD21_RS04110 (QRD21_04110) | 858556..859269 | + | 714 | WP_046876663.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QRD21_RS04115 (QRD21_04115) | 859275..861008 | + | 1734 | WP_046876664.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16074.91 Da Isoelectric Point: 10.9455
>T284320 WP_046876661.1 NZ_CP127873:856575-856985 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6P1V2U3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H3L9 |