Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1355685..1356244 Replicon chromosome
Accession NZ_CP127846
Organism Vibrio parahaemolyticus strain VP16

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QRT07_RS06405 Protein ID WP_020838852.1
Coordinates 1355685..1355963 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QRT07_RS06410 Protein ID WP_020838853.1
Coordinates 1355960..1356244 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRT07_RS06375 (QRT07_06375) 1350858..1350947 + 90 WP_286089475.1 DUF3265 domain-containing protein -
QRT07_RS06380 (QRT07_06380) 1350985..1352454 + 1470 WP_240305319.1 hypothetical protein -
QRT07_RS06385 (QRT07_06385) 1352478..1352570 + 93 WP_080252015.1 DUF3265 domain-containing protein -
QRT07_RS06390 (QRT07_06390) 1352643..1353248 + 606 WP_286089461.1 hypothetical protein -
QRT07_RS06395 (QRT07_06395) 1353516..1354568 - 1053 WP_046209702.1 IS91 family transposase -
QRT07_RS06400 (QRT07_06400) 1354565..1355452 - 888 WP_046209703.1 site-specific integrase -
QRT07_RS06405 (QRT07_06405) 1355685..1355963 - 279 WP_020838852.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QRT07_RS06410 (QRT07_06410) 1355960..1356244 - 285 WP_020838853.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QRT07_RS06415 (QRT07_06415) 1356324..1356413 + 90 WP_074534800.1 DUF3265 domain-containing protein -
QRT07_RS06420 (QRT07_06420) 1356463..1356870 + 408 WP_020838854.1 OsmC family protein -
QRT07_RS06425 (QRT07_06425) 1357123..1358175 - 1053 WP_046209702.1 IS91 family transposase -
QRT07_RS06430 (QRT07_06430) 1358172..1359059 - 888 WP_046209703.1 site-specific integrase -
QRT07_RS06435 (QRT07_06435) 1359303..1359848 + 546 WP_020838855.1 N-acetyltransferase -
QRT07_RS06440 (QRT07_06440) 1360101..1361153 - 1053 WP_046209702.1 IS91 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1332325..1398659 66334
- inside IScluster/Tn - - 1354565..1389486 34921
- inside Integron - - 1332849..1350790 17941
- inside Integron - - 1354565..1367278 12713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10921.66 Da        Isoelectric Point: 4.3430

>T284274 WP_020838852.1 NZ_CP127846:c1355963-1355685 [Vibrio parahaemolyticus]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGVRGRLLIIPEISMIVSYWVEGDIIRIM
RVLHQKQKFPMD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11039.37 Da        Isoelectric Point: 9.2167

>AT284274 WP_020838853.1 NZ_CP127846:c1356244-1355960 [Vibrio parahaemolyticus]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLADQQRKTLSHDAWLTEQVNLAFEKFDSGKAVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References