Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1608619..1609163 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QQ658_RS07350 | Protein ID | WP_286026999.1 |
| Coordinates | 1608858..1609163 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QQ658_RS07345 | Protein ID | WP_286026998.1 |
| Coordinates | 1608619..1608852 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS07325 (QQ658_07325) | 1603913..1605070 | - | 1158 | WP_286026994.1 | homoserine O-acetyltransferase | - |
| QQ658_RS07330 (QQ658_07330) | 1605087..1606388 | - | 1302 | WP_286026995.1 | O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase | - |
| QQ658_RS07335 (QQ658_07335) | 1606476..1607483 | - | 1008 | WP_286026996.1 | ABC transporter substrate-binding protein | - |
| QQ658_RS07340 (QQ658_07340) | 1607494..1608309 | - | 816 | WP_286026997.1 | ABC transporter permease | - |
| QQ658_RS07345 (QQ658_07345) | 1608619..1608852 | + | 234 | WP_286026998.1 | antitoxin | Antitoxin |
| QQ658_RS07350 (QQ658_07350) | 1608858..1609163 | + | 306 | WP_286026999.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QQ658_RS07355 (QQ658_07355) | 1609207..1610739 | - | 1533 | WP_286027000.1 | DHA2 family efflux MFS transporter permease subunit | - |
| QQ658_RS07360 (QQ658_07360) | 1610883..1612337 | - | 1455 | WP_286027001.1 | MFS transporter | - |
| QQ658_RS07365 (QQ658_07365) | 1612392..1613702 | - | 1311 | WP_286027002.1 | MATE family efflux transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11136.94 Da Isoelectric Point: 5.7783
>T284235 WP_286026999.1 NZ_CP127390:1608858-1609163 [Propionimicrobium sp. PCR01-08-3]
MRPIYLARLDKTRPVLVLTRELVRPYLNSVTVAPITSTIRGLSTELPVGSRNGLDHDCVVSLDNIVTITVKDLGRQIGFL
LPDQEGNLTEAMMNAFDLVTS
MRPIYLARLDKTRPVLVLTRELVRPYLNSVTVAPITSTIRGLSTELPVGSRNGLDHDCVVSLDNIVTITVKDLGRQIGFL
LPDQEGNLTEAMMNAFDLVTS
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|