Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
| Location | 334653..335161 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QQ658_RS01605 | Protein ID | WP_286025943.1 |
| Coordinates | 334901..335161 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | QQ658_RS01600 | Protein ID | WP_286025942.1 |
| Coordinates | 334653..334904 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS01580 (QQ658_01580) | 330182..330955 | - | 774 | WP_286025938.1 | ABC transporter permease | - |
| QQ658_RS01585 (QQ658_01585) | 330963..331769 | - | 807 | WP_286025939.1 | ATP-binding cassette domain-containing protein | - |
| QQ658_RS01590 (QQ658_01590) | 331973..332635 | - | 663 | WP_286025940.1 | CatB-related O-acetyltransferase | - |
| QQ658_RS01595 (QQ658_01595) | 332801..334450 | - | 1650 | WP_286025941.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| QQ658_RS01600 (QQ658_01600) | 334653..334904 | + | 252 | WP_286025942.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQ658_RS01605 (QQ658_01605) | 334901..335161 | + | 261 | WP_286025943.1 | Txe/YoeB family addiction module toxin | Toxin |
| QQ658_RS01610 (QQ658_01610) | 335409..336764 | - | 1356 | WP_286025944.1 | C1 family peptidase | - |
| QQ658_RS01615 (QQ658_01615) | 337070..338533 | + | 1464 | WP_286025945.1 | Nramp family divalent metal transporter | - |
| QQ658_RS01620 (QQ658_01620) | 338631..339044 | - | 414 | WP_286025946.1 | DUF1801 domain-containing protein | - |
| QQ658_RS01625 (QQ658_01625) | 339276..339527 | + | 252 | WP_286025947.1 | addiction module protein | - |
| QQ658_RS01630 (QQ658_01630) | 339524..339844 | + | 321 | WP_286025948.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10066.54 Da Isoelectric Point: 8.9165
>T284231 WP_286025943.1 NZ_CP127390:334901-335161 [Propionimicrobium sp. PCR01-08-3]
VKLVITANGWNDYCHWQETDRATLKRVNKLIDAAMRTPKDGIGKPEALKYQLGEVWSRRITEEHRLVYRIGDAEIIILQA
RFHYDA
VKLVITANGWNDYCHWQETDRATLKRVNKLIDAAMRTPKDGIGKPEALKYQLGEVWSRRITEEHRLVYRIGDAEIIILQA
RFHYDA
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|