Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 3908882..3909515 | Replicon | chromosome |
| Accession | NZ_CP127360 | ||
| Organism | Paracidovorax citrulli strain KACC 18784 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A1TJP6 |
| Locus tag | QRO10_RS18160 | Protein ID | WP_011793755.1 |
| Coordinates | 3908882..3909295 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6B0DRJ9 |
| Locus tag | QRO10_RS18165 | Protein ID | WP_041827216.1 |
| Coordinates | 3909282..3909515 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRO10_RS18135 (QRO10_18135) | 3903889..3904926 | - | 1038 | WP_011793760.1 | anthranilate phosphoribosyltransferase | - |
| QRO10_RS18140 (QRO10_18140) | 3904959..3905642 | - | 684 | WP_011793759.1 | LysE family translocator | - |
| QRO10_RS18145 (QRO10_18145) | 3905714..3906286 | - | 573 | WP_011793758.1 | aminodeoxychorismate/anthranilate synthase component II | - |
| QRO10_RS18150 (QRO10_18150) | 3906971..3908485 | + | 1515 | WP_011793757.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| QRO10_RS18155 (QRO10_18155) | 3908499..3908861 | - | 363 | WP_011793756.1 | DUF3742 family protein | - |
| QRO10_RS18160 (QRO10_18160) | 3908882..3909295 | - | 414 | WP_011793755.1 | PIN domain-containing protein | Toxin |
| QRO10_RS18165 (QRO10_18165) | 3909282..3909515 | - | 234 | WP_041827216.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3864915..4017251 | 152336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15147.48 Da Isoelectric Point: 6.2136
>T284202 WP_011793755.1 NZ_CP127360:c3909295-3908882 [Paracidovorax citrulli]
MAAGKGKVFLDSNVVLYLLSEDAAKADSAEALLHRRPVISVQVLNEVTHVCVRKLKMGWGEVGQFLALVREFCSIVPLTV
EVHDRARQLAERHQLSFYDACIVAAAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV
MAAGKGKVFLDSNVVLYLLSEDAAKADSAEALLHRRPVISVQVLNEVTHVCVRKLKMGWGEVGQFLALVREFCSIVPLTV
EVHDRARQLAERHQLSFYDACIVAAAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A1TJP6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B0DRJ9 |