Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4640463..4641013 Replicon chromosome
Accession NZ_CP127314
Organism Escherichia coli strain C25

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QRM69_RS22485 Protein ID WP_001160966.1
Coordinates 4640463..4640777 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QRM69_RS22490 Protein ID WP_000125566.1
Coordinates 4640780..4641013 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM69_RS22460 (4636138) 4636138..4637424 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QRM69_RS22465 (4637424) 4637424..4638413 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QRM69_RS22470 (4638410) 4638410..4639231 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QRM69_RS22475 (4639234) 4639234..4639611 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QRM69_RS22480 (4639618) 4639618..4640466 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QRM69_RS22485 (4640463) 4640463..4640777 - 315 WP_001160966.1 CcdB family protein Toxin
QRM69_RS22490 (4640780) 4640780..4641013 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QRM69_RS22495 (4641099) 4641099..4641578 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QRM69_RS22500 (4641770) 4641770..4643632 - 1863 WP_000377123.1 glutathione-regulated potassium-efflux system protein KefC -
QRM69_RS22505 (4643625) 4643625..4644155 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QRM69_RS22510 (4644263) 4644263..4645594 - 1332 WP_001183207.1 MFS transporter -
QRM69_RS22515 (4645653) 4645653..4645940 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T284155 WP_001160966.1 NZ_CP127314:c4640777-4640463 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT284155 WP_000125566.1 NZ_CP127314:c4641013-4640780 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References