Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3482769..3483603 | Replicon | chromosome |
| Accession | NZ_CP127314 | ||
| Organism | Escherichia coli strain C25 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | QRM69_RS16990 | Protein ID | WP_000854690.1 |
| Coordinates | 3482769..3483146 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QRM69_RS16995 | Protein ID | WP_001546171.1 |
| Coordinates | 3483235..3483603 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM69_RS16955 (3478360) | 3478360..3478914 | - | 555 | WP_001001909.1 | molecular chaperone YcdY | - |
| QRM69_RS16960 (3478938) | 3478938..3479675 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QRM69_RS16965 (3479730) | 3479730..3480668 | - | 939 | WP_000351287.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QRM69_RS16975 (3481139) | 3481139..3481982 | - | 844 | Protein_3314 | DUF4942 domain-containing protein | - |
| QRM69_RS16980 (3482067) | 3482067..3482264 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| QRM69_RS16985 (3482284) | 3482284..3482772 | - | 489 | WP_001546173.1 | DUF5983 family protein | - |
| QRM69_RS16990 (3482769) | 3482769..3483146 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| QRM69_RS16995 (3483235) | 3483235..3483603 | - | 369 | WP_001546171.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM69_RS17000 (3483653) | 3483653..3484297 | - | 645 | WP_000094915.1 | hypothetical protein | - |
| QRM69_RS17005 (3484316) | 3484316..3484537 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QRM69_RS17010 (3484600) | 3484600..3485076 | - | 477 | WP_001537421.1 | RadC family protein | - |
| QRM69_RS17015 (3485092) | 3485092..3485565 | - | 474 | WP_000855076.1 | antirestriction protein | - |
| QRM69_RS17020 (3485828) | 3485828..3486649 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| QRM69_RS17025 (3486828) | 3486828..3486917 | - | 90 | WP_230607454.1 | DUF905 family protein | - |
| QRM69_RS17030 (3487060) | 3487060..3487515 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T284152 WP_000854690.1 NZ_CP127314:c3483146-3482769 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13745.37 Da Isoelectric Point: 4.6220
>AT284152 WP_001546171.1 NZ_CP127314:c3483603-3483235 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|