Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2252648..2253445 | Replicon | chromosome |
| Accession | NZ_CP127306 | ||
| Organism | Escherichia coli strain C51 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QRM70_RS10910 | Protein ID | WP_115722695.1 |
| Coordinates | 2252648..2253025 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QRM70_RS10915 | Protein ID | WP_115722696.1 |
| Coordinates | 2253071..2253445 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM70_RS10885 (2248548) | 2248548..2249084 | + | 537 | WP_000942795.1 | GspM family type II secretion system protein YghD | - |
| QRM70_RS10890 (2249419) | 2249419..2250954 | - | 1536 | WP_285965561.1 | EAL domain-containing protein | - |
| QRM70_RS10895 (2251025) | 2251025..2251869 | - | 845 | Protein_2095 | DUF4942 domain-containing protein | - |
| QRM70_RS10900 (2251954) | 2251954..2252151 | - | 198 | WP_000839250.1 | DUF957 domain-containing protein | - |
| QRM70_RS10905 (2252163) | 2252163..2252651 | - | 489 | WP_053272397.1 | DUF5983 family protein | - |
| QRM70_RS10910 (2252648) | 2252648..2253025 | - | 378 | WP_115722695.1 | TA system toxin CbtA family protein | Toxin |
| QRM70_RS10915 (2253071) | 2253071..2253445 | - | 375 | WP_115722696.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM70_RS10920 (2253525) | 2253525..2253746 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| QRM70_RS10925 (2253809) | 2253809..2254285 | - | 477 | WP_122989279.1 | RadC family protein | - |
| QRM70_RS10930 (2254300) | 2254300..2254785 | - | 486 | WP_053272402.1 | antirestriction protein | - |
| QRM70_RS10935 (2254862) | 2254862..2255680 | - | 819 | WP_061362203.1 | DUF932 domain-containing protein | - |
| QRM70_RS10940 (2255771) | 2255771..2255992 | - | 222 | WP_061362202.1 | DUF905 family protein | - |
| QRM70_RS10945 (2256068) | 2256068..2256604 | - | 537 | WP_001000101.1 | DUF4234 domain-containing protein | - |
| QRM70_RS10950 (2256667) | 2256667..2257968 | - | 1302 | WP_061362201.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papI / papB / papH / papC / papC / papD / papJ / papK / papE / papF | 2249238..2310435 | 61197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14077.07 Da Isoelectric Point: 8.2904
>T284114 WP_115722695.1 NZ_CP127306:c2253025-2252648 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDSPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDSPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13679.32 Da Isoelectric Point: 5.8640
>AT284114 WP_115722696.1 NZ_CP127306:c2253445-2253071 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|