Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 3801661..3802346 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TIR9 |
Locus tag | QRF09_RS17925 | Protein ID | WP_003417998.1 |
Coordinates | 3801936..3802346 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QRF09_RS17920 | Protein ID | WP_180895138.1 |
Coordinates | 3801661..3801939 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS17900 (QRF09_17900) | 3797650..3799251 | - | 1602 | WP_003417969.1 | FAD/NAD(P)-binding protein | - |
QRF09_RS17905 (QRF09_17905) | 3799268..3799972 | - | 705 | WP_003417980.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
QRF09_RS17910 (QRF09_17910) | 3800090..3800656 | - | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
QRF09_RS17915 (QRF09_17915) | 3800718..3801605 | + | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
QRF09_RS17920 (QRF09_17920) | 3801661..3801939 | + | 279 | WP_180895138.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QRF09_RS17925 (QRF09_17925) | 3801936..3802346 | + | 411 | WP_003417998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF09_RS17930 (QRF09_17930) | 3802379..3804115 | - | 1737 | WP_003418002.1 | cholesterol oxidase | - |
QRF09_RS17935 (QRF09_17935) | 3804171..3805298 | - | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
QRF09_RS17940 (QRF09_17940) | 3805318..3806907 | - | 1590 | WP_003901630.1 | IMP dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14695.84 Da Isoelectric Point: 5.1784
>T283927 WP_003417998.1 NZ_CP127275:3801936-3802346 [Mycobacterium tuberculosis]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|