Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3112018..3112622 Replicon chromosome
Accession NZ_CP127275
Organism Mycobacterium tuberculosis strain 6721

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag QRF09_RS14860 Protein ID WP_003414492.1
Coordinates 3112018..3112410 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag QRF09_RS14865 Protein ID WP_003414495.1
Coordinates 3112407..3112622 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF09_RS14830 (QRF09_14830) 3107168..3107956 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
QRF09_RS14835 (QRF09_14835) 3108290..3108835 - 546 WP_014584866.1 DUF1802 family protein -
QRF09_RS14840 (QRF09_14840) 3109107..3109991 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QRF09_RS14845 (QRF09_14845) 3109994..3110881 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
QRF09_RS14850 (QRF09_14850) 3111186..3111731 - 546 WP_003910939.1 DUF1802 family protein -
QRF09_RS14855 (QRF09_14855) 3111728..3111997 - 270 WP_003414489.1 DUF2277 family protein -
QRF09_RS14860 (QRF09_14860) 3112018..3112410 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF09_RS14865 (QRF09_14865) 3112407..3112622 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QRF09_RS14870 (QRF09_14870) 3112669..3113418 + 750 WP_003902358.1 enoyl-CoA hydratase -
QRF09_RS14875 (QRF09_14875) 3113497..3114579 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
QRF09_RS14880 (QRF09_14880) 3114572..3115882 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
QRF09_RS14885 (QRF09_14885) 3115885..3116712 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
QRF09_RS14890 (QRF09_14890) 3116709..3117620 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T283920 WP_003414492.1 NZ_CP127275:c3112410-3112018 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT283920 WP_003414495.1 NZ_CP127275:c3112622-3112407 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References