Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3089276..3089846 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | QRF09_RS14730 | Protein ID | WP_003414166.1 |
Coordinates | 3089276..3089632 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | QRF09_RS14735 | Protein ID | WP_003901465.1 |
Coordinates | 3089616..3089846 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS14710 (QRF09_14710) | 3084728..3086416 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
QRF09_RS14715 (QRF09_14715) | 3086420..3086746 | - | 327 | WP_003414157.1 | hypothetical protein | - |
QRF09_RS14720 (QRF09_14720) | 3086919..3087506 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
QRF09_RS14725 (QRF09_14725) | 3087525..3089174 | + | 1650 | Protein_2906 | CocE/NonD family hydrolase | - |
QRF09_RS14730 (QRF09_14730) | 3089276..3089632 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
QRF09_RS14735 (QRF09_14735) | 3089616..3089846 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
QRF09_RS14740 (QRF09_14740) | 3089889..3090932 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
QRF09_RS14745 (QRF09_14745) | 3090931..3091398 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
QRF09_RS14750 (QRF09_14750) | 3091574..3091828 | - | 255 | WP_003917684.1 | hypothetical protein | - |
QRF09_RS14755 (QRF09_14755) | 3091976..3092380 | + | 405 | WP_003414181.1 | hypothetical protein | - |
QRF09_RS14760 (QRF09_14760) | 3092377..3092568 | + | 192 | WP_003414184.1 | hypothetical protein | - |
QRF09_RS14765 (QRF09_14765) | 3092785..3093045 | + | 261 | Protein_2914 | transposase | - |
QRF09_RS14770 (QRF09_14770) | 3094155..3094412 | + | 258 | WP_003899489.1 | hypothetical protein | - |
QRF09_RS14775 (QRF09_14775) | 3094517..3094828 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T283918 WP_003414166.1 NZ_CP127275:c3089632-3089276 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|