Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3049692..3050379 Replicon chromosome
Accession NZ_CP127275
Organism Mycobacterium tuberculosis strain 6721

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag QRF09_RS14510 Protein ID WP_003414064.1
Coordinates 3049984..3050379 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag QRF09_RS14505 Protein ID WP_003414061.1
Coordinates 3049692..3049958 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF09_RS14480 (QRF09_14480) 3045331..3046233 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
QRF09_RS14485 (QRF09_14485) 3046302..3047054 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
QRF09_RS14490 (QRF09_14490) 3047298..3047573 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
QRF09_RS14495 (QRF09_14495) 3047570..3049192 - 1623 WP_003414057.1 class I SAM-dependent DNA methyltransferase -
QRF09_RS14500 (QRF09_14500) 3049279..3049695 - 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
QRF09_RS14505 (QRF09_14505) 3049692..3049958 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRF09_RS14510 (QRF09_14510) 3049984..3050379 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF09_RS14515 (QRF09_14515) 3050376..3050645 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
QRF09_RS14520 (QRF09_14520) 3050655..3051749 - 1095 WP_003414068.1 restriction endonuclease subunit S -
QRF09_RS14525 (QRF09_14525) 3051746..3052165 - 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
QRF09_RS14530 (QRF09_14530) 3052164..3052238 + 75 Protein_2867 hypothetical protein -
QRF09_RS14535 (QRF09_14535) 3052239..3052718 - 480 WP_003414073.1 dihydrofolate reductase -
QRF09_RS14540 (QRF09_14540) 3052789..3053589 - 801 WP_003911953.1 thymidylate synthase -
QRF09_RS14545 (QRF09_14545) 3053745..3054482 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T283917 WP_003414064.1 NZ_CP127275:c3050379-3049984 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT283917 WP_003414061.1 NZ_CP127275:c3049958-3049692 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References