Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2344108..2344803 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QRF09_RS10985 | Protein ID | WP_003905754.1 |
Coordinates | 2344108..2344542 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TMN0 |
Locus tag | QRF09_RS10990 | Protein ID | WP_003410814.1 |
Coordinates | 2344549..2344803 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS10975 (QRF09_10975) | 2340262..2343303 | + | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
QRF09_RS10980 (QRF09_10980) | 2343296..2344129 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
QRF09_RS10985 (QRF09_10985) | 2344108..2344542 | - | 435 | WP_003905754.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF09_RS10990 (QRF09_10990) | 2344549..2344803 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
QRF09_RS10995 (QRF09_10995) | 2344819..2345076 | - | 258 | WP_003410816.1 | hypothetical protein | - |
QRF09_RS11000 (QRF09_11000) | 2345487..2346748 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
QRF09_RS11005 (QRF09_11005) | 2347381..2347677 | + | 297 | WP_003410820.1 | PE family protein | - |
QRF09_RS11010 (QRF09_11010) | 2347733..2348464 | + | 732 | WP_003900467.1 | PPE family protein | - |
QRF09_RS11015 (QRF09_11015) | 2349005..2349751 | - | 747 | WP_003901330.1 | proteasome subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15632.05 Da Isoelectric Point: 7.4681
>T283907 WP_003905754.1 NZ_CP127275:c2344542-2344108 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTASEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTASEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|