Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2246827..2247746 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | L7N4R2 |
Locus tag | QRF09_RS10575 | Protein ID | WP_003900449.1 |
Coordinates | 2247141..2247746 (-) | Length | 202 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | L7N5K9 |
Locus tag | QRF09_RS10570 | Protein ID | WP_003410124.1 |
Coordinates | 2246827..2247132 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS10540 (QRF09_10540) | 2241838..2243094 | - | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
QRF09_RS10545 (QRF09_10545) | 2243448..2244023 | + | 576 | WP_003410100.1 | hypothetical protein | - |
QRF09_RS10550 (QRF09_10550) | 2244020..2245060 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
QRF09_RS10555 (QRF09_10555) | 2245302..2246021 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
QRF09_RS10560 (QRF09_10560) | 2246011..2246427 | + | 417 | WP_003410114.1 | hypothetical protein | - |
QRF09_RS10565 (QRF09_10565) | 2246443..2246742 | - | 300 | WP_003410120.1 | hypothetical protein | - |
QRF09_RS10570 (QRF09_10570) | 2246827..2247132 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
QRF09_RS10575 (QRF09_10575) | 2247141..2247746 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF09_RS10580 (QRF09_10580) | 2247771..2248130 | - | 360 | WP_003410131.1 | hypothetical protein | - |
QRF09_RS10585 (QRF09_10585) | 2248290..2248685 | - | 396 | WP_225936727.1 | hypothetical protein | - |
QRF09_RS10590 (QRF09_10590) | 2248745..2250262 | - | 1518 | Protein_2093 | DEAD/DEAH box helicase family protein | - |
QRF09_RS10595 (QRF09_10595) | 2250772..2251770 | - | 999 | WP_003410146.1 | cation diffusion facilitator family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T283905 WP_003900449.1 NZ_CP127275:c2247746-2247141 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV20 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7EWC | |
PDB | 7EWD | |
PDB | 7EWE | |
AlphaFold DB | A0A7U4BV30 |