Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2184043..2184587 Replicon chromosome
Accession NZ_CP127275
Organism Mycobacterium tuberculosis strain 6721

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag QRF09_RS10220 Protein ID WP_003409896.1
Coordinates 2184043..2184339 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag QRF09_RS10225 Protein ID WP_003409899.1
Coordinates 2184336..2184587 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF09_RS10165 (QRF09_10165) 2179076..2179426 - 351 WP_003409871.1 hypothetical protein -
QRF09_RS10170 (QRF09_10170) 2179437..2180339 - 903 WP_003899097.1 hypothetical protein -
QRF09_RS10175 (QRF09_10175) 2180360..2180551 - 192 WP_003409876.1 hypothetical protein -
QRF09_RS10180 (QRF09_10180) 2180552..2180848 - 297 WP_003409877.1 hypothetical protein -
QRF09_RS10185 (QRF09_10185) 2181088..2181303 + 216 WP_003409878.1 antitoxin -
QRF09_RS10190 (QRF09_10190) 2181300..2181611 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
QRF09_RS10195 (QRF09_10195) 2181585..2182106 - 522 WP_003904745.1 hypothetical protein -
QRF09_RS10200 (QRF09_10200) 2182081..2182458 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
QRF09_RS10205 (QRF09_10205) 2182500..2182949 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
QRF09_RS10210 (QRF09_10210) 2182946..2183491 + 546 WP_003409891.1 SecB-like chaperone -
QRF09_RS10215 (QRF09_10215) 2183380..2183994 - 615 WP_003901296.1 hypothetical protein -
QRF09_RS10220 (QRF09_10220) 2184043..2184339 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRF09_RS10225 (QRF09_10225) 2184336..2184587 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
QRF09_RS10230 (QRF09_10230) 2184574..2185068 + 495 WP_003899099.1 hypothetical protein -
QRF09_RS10235 (QRF09_10235) 2185228..2185635 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
QRF09_RS10240 (QRF09_10240) 2185639..2185911 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QRF09_RS10245 (QRF09_10245) 2185944..2187164 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
QRF09_RS10250 (QRF09_10250) 2188062..2188859 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T283900 WP_003409896.1 NZ_CP127275:c2184339-2184043 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT283900 WP_003409899.1 NZ_CP127275:c2184587-2184336 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References