Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1226973..1227604 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
Locus tag | QRF09_RS05875 | Protein ID | WP_003405820.1 |
Coordinates | 1226973..1227284 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | QRF09_RS05880 | Protein ID | WP_003405836.1 |
Coordinates | 1227284..1227604 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS05855 (QRF09_05855) | 1222454..1223878 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
QRF09_RS05860 (QRF09_05860) | 1223909..1224997 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
QRF09_RS05865 (QRF09_05865) | 1225053..1225697 | + | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
QRF09_RS05870 (QRF09_05870) | 1225704..1226861 | - | 1158 | WP_003898727.1 | AI-2E family transporter | - |
QRF09_RS05875 (QRF09_05875) | 1226973..1227284 | - | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
QRF09_RS05880 (QRF09_05880) | 1227284..1227604 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
QRF09_RS05885 (QRF09_05885) | 1227614..1229150 | + | 1537 | Protein_1159 | carboxylesterase/lipase family protein | - |
QRF09_RS05890 (QRF09_05890) | 1229157..1230269 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
QRF09_RS05895 (QRF09_05895) | 1230279..1230536 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
QRF09_RS05900 (QRF09_05900) | 1230526..1231773 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
QRF09_RS05905 (QRF09_05905) | 1231770..1232408 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T283888 WP_003405820.1 NZ_CP127275:c1227284-1226973 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F9D0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TGZ7 |