Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1011009..1011628 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | QRF09_RS04800 | Protein ID | WP_003404726.1 |
Coordinates | 1011194..1011628 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ06 |
Locus tag | QRF09_RS04795 | Protein ID | WP_003898641.1 |
Coordinates | 1011009..1011188 (+) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS04780 (QRF09_04780) | 1006483..1008062 | + | 1580 | Protein_942 | serine hydrolase | - |
QRF09_RS04785 (QRF09_04785) | 1008059..1010452 | + | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
QRF09_RS04790 (QRF09_04790) | 1010725..1010883 | + | 159 | WP_003404720.1 | hypothetical protein | - |
QRF09_RS04795 (QRF09_04795) | 1011009..1011188 | + | 180 | WP_003898641.1 | antitoxin | Antitoxin |
QRF09_RS04800 (QRF09_04800) | 1011194..1011628 | + | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
QRF09_RS04805 (QRF09_04805) | 1011726..1012499 | + | 774 | WP_003404735.1 | VOC family protein | - |
QRF09_RS04810 (QRF09_04810) | 1012564..1013013 | + | 450 | WP_003404738.1 | hypothetical protein | - |
QRF09_RS04815 (QRF09_04815) | 1013148..1013378 | - | 231 | WP_003898642.1 | hypothetical protein | - |
QRF09_RS04820 (QRF09_04820) | 1013545..1015053 | - | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
QRF09_RS04825 (QRF09_04825) | 1015055..1016293 | - | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T283885 WP_003404726.1 NZ_CP127275:1011194-1011628 [Mycobacterium tuberculosis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|