Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 712927..713576 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | QRF09_RS03265 | Protein ID | WP_003403236.1 |
Coordinates | 713181..713576 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | QRF09_RS03260 | Protein ID | WP_003403235.1 |
Coordinates | 712927..713181 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS03235 (QRF09_03235) | 708053..708136 | + | 84 | Protein_641 | galactose-1-phosphate uridylyltransferase | - |
QRF09_RS03240 (QRF09_03240) | 708155..709236 | + | 1082 | Protein_642 | galactose-1-phosphate uridylyltransferase | - |
QRF09_RS03245 (QRF09_03245) | 709233..710324 | + | 1092 | WP_003900977.1 | galactokinase | - |
QRF09_RS03250 (QRF09_03250) | 710719..711783 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
QRF09_RS03255 (QRF09_03255) | 711887..712834 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
QRF09_RS03260 (QRF09_03260) | 712927..713181 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
QRF09_RS03265 (QRF09_03265) | 713181..713576 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
QRF09_RS03270 (QRF09_03270) | 713670..714410 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
QRF09_RS03275 (QRF09_03275) | 714542..714802 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QRF09_RS03280 (QRF09_03280) | 714799..715206 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF09_RS03285 (QRF09_03285) | 715278..716429 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
QRF09_RS03290 (QRF09_03290) | 716522..718249 | - | 1728 | WP_003901883.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T283878 WP_003403236.1 NZ_CP127275:713181-713576 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ | |
AlphaFold DB | A0A7U4BSC2 |