Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Rv0299-vapB/- |
Location | 360101..360672 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | Rv0299 | Uniprot ID | - |
Locus tag | QRF09_RS01560 | Protein ID | WP_003401560.1 |
Coordinates | 360101..360403 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O07227 |
Locus tag | QRF09_RS01565 | Protein ID | WP_003401563.1 |
Coordinates | 360451..360672 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS01540 (QRF09_01540) | 355570..356373 | - | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
QRF09_RS01545 (QRF09_01545) | 356383..357780 | - | 1398 | WP_003401544.1 | sulfatase | - |
QRF09_RS01550 (QRF09_01550) | 357959..359734 | + | 1776 | WP_010886074.1 | PE family protein | - |
QRF09_RS01555 (QRF09_01555) | 359877..360104 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
QRF09_RS01560 (QRF09_01560) | 360101..360403 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
QRF09_RS01565 (QRF09_01565) | 360451..360672 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
QRF09_RS01570 (QRF09_01570) | 360669..361094 | + | 426 | WP_003401566.1 | PIN domain nuclease | - |
QRF09_RS01575 (QRF09_01575) | 361230..361862 | + | 633 | WP_003905275.1 | TetR/AcrR family transcriptional regulator | - |
QRF09_RS01580 (QRF09_01580) | 361859..362767 | + | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
QRF09_RS01585 (QRF09_01585) | 362775..363365 | - | 591 | WP_229298012.1 | hypothetical protein | - |
QRF09_RS01590 (QRF09_01590) | 363358..363408 | - | 51 | Protein_314 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T283869 WP_003401560.1 NZ_CP127275:360101-360403 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|