Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4925479..4926314 | Replicon | chromosome |
| Accession | NZ_CP127255 | ||
| Organism | Escherichia coli strain Q5 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QQ972_RS23900 | Protein ID | WP_029402447.1 |
| Coordinates | 4925937..4926314 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3Z2YIX3 |
| Locus tag | QQ972_RS23895 | Protein ID | WP_032178229.1 |
| Coordinates | 4925479..4925847 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ972_RS23855 (4920761) | 4920761..4921441 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QQ972_RS23860 (4921589) | 4921589..4922266 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QQ972_RS23865 (4922272) | 4922272..4922505 | + | 234 | WP_032288847.1 | DUF905 family protein | - |
| QQ972_RS23870 (4922595) | 4922595..4923413 | + | 819 | WP_024214765.1 | DUF932 domain-containing protein | - |
| QQ972_RS23875 (4923505) | 4923505..4923990 | + | 486 | WP_071045790.1 | antirestriction protein | - |
| QQ972_RS23880 (4924006) | 4924006..4924482 | + | 477 | WP_122996610.1 | RadC family protein | - |
| QQ972_RS23885 (4924545) | 4924545..4924766 | + | 222 | WP_000692326.1 | DUF987 domain-containing protein | - |
| QQ972_RS23890 (4924785) | 4924785..4925429 | + | 645 | WP_285984909.1 | antitoxin of toxin-antitoxin stability system | - |
| QQ972_RS23895 (4925479) | 4925479..4925847 | + | 369 | WP_032178229.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQ972_RS23900 (4925937) | 4925937..4926314 | + | 378 | WP_029402447.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QQ972_RS23905 (4926311) | 4926311..4926460 | + | 150 | Protein_4667 | DUF5983 family protein | - |
| QQ972_RS23910 (4926536) | 4926536..4926733 | + | 198 | WP_097471913.1 | DUF957 domain-containing protein | - |
| QQ972_RS23915 (4926818) | 4926818..4927684 | + | 867 | WP_024257423.1 | DUF4942 domain-containing protein | - |
| QQ972_RS23920 (4927756) | 4927756..4928019 | + | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| QQ972_RS23925 (4928016) | 4928016..4928342 | + | 327 | WP_000779482.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QQ972_RS23930 (4928806) | 4928806..4930071 | + | 1266 | WP_097751982.1 | integrase arm-type DNA-binding domain-containing protein | - |
| QQ972_RS23935 (4930653) | 4930653..4930889 | + | 237 | Protein_4673 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | papD / papC / papC | 4869444..4948270 | 78826 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13900.92 Da Isoelectric Point: 8.5163
>T283738 WP_029402447.1 NZ_CP127255:4925937-4926314 [Escherichia coli]
MKTLPVLPGQAAGSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAAGSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13823.58 Da Isoelectric Point: 6.3177
>AT283738 WP_032178229.1 NZ_CP127255:4925479-4925847 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|