Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4925479..4926314 Replicon chromosome
Accession NZ_CP127255
Organism Escherichia coli strain Q5

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QQ972_RS23900 Protein ID WP_029402447.1
Coordinates 4925937..4926314 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3Z2YIX3
Locus tag QQ972_RS23895 Protein ID WP_032178229.1
Coordinates 4925479..4925847 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ972_RS23855 (4920761) 4920761..4921441 + 681 WP_001282919.1 WYL domain-containing protein -
QQ972_RS23860 (4921589) 4921589..4922266 + 678 WP_001097301.1 hypothetical protein -
QQ972_RS23865 (4922272) 4922272..4922505 + 234 WP_032288847.1 DUF905 family protein -
QQ972_RS23870 (4922595) 4922595..4923413 + 819 WP_024214765.1 DUF932 domain-containing protein -
QQ972_RS23875 (4923505) 4923505..4923990 + 486 WP_071045790.1 antirestriction protein -
QQ972_RS23880 (4924006) 4924006..4924482 + 477 WP_122996610.1 RadC family protein -
QQ972_RS23885 (4924545) 4924545..4924766 + 222 WP_000692326.1 DUF987 domain-containing protein -
QQ972_RS23890 (4924785) 4924785..4925429 + 645 WP_285984909.1 antitoxin of toxin-antitoxin stability system -
QQ972_RS23895 (4925479) 4925479..4925847 + 369 WP_032178229.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQ972_RS23900 (4925937) 4925937..4926314 + 378 WP_029402447.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQ972_RS23905 (4926311) 4926311..4926460 + 150 Protein_4667 DUF5983 family protein -
QQ972_RS23910 (4926536) 4926536..4926733 + 198 WP_097471913.1 DUF957 domain-containing protein -
QQ972_RS23915 (4926818) 4926818..4927684 + 867 WP_024257423.1 DUF4942 domain-containing protein -
QQ972_RS23920 (4927756) 4927756..4928019 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
QQ972_RS23925 (4928016) 4928016..4928342 + 327 WP_000779482.1 type II toxin-antitoxin system RelE/ParE family toxin -
QQ972_RS23930 (4928806) 4928806..4930071 + 1266 WP_097751982.1 integrase arm-type DNA-binding domain-containing protein -
QQ972_RS23935 (4930653) 4930653..4930889 + 237 Protein_4673 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - papD / papC / papC 4869444..4948270 78826


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13900.92 Da        Isoelectric Point: 8.5163

>T283738 WP_029402447.1 NZ_CP127255:4925937-4926314 [Escherichia coli]
MKTLPVLPGQAAGSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13823.58 Da        Isoelectric Point: 6.3177

>AT283738 WP_032178229.1 NZ_CP127255:4925479-4925847 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3Z2YIX3

References