Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1926562..1927369 | Replicon | chromosome |
Accession | NZ_CP127255 | ||
Organism | Escherichia coli strain Q5 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A8E2S9W0 |
Locus tag | QQ972_RS09225 | Protein ID | WP_042004473.1 |
Coordinates | 1926562..1926948 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0P7R0L9 |
Locus tag | QQ972_RS09230 | Protein ID | WP_001285482.1 |
Coordinates | 1926995..1927369 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ972_RS09200 (1921929) | 1921929..1923522 | + | 1594 | Protein_1784 | IS66 family transposase | - |
QQ972_RS09205 (1923670) | 1923670..1924658 | + | 989 | Protein_1785 | IS630 family transposase | - |
QQ972_RS09210 (1924737) | 1924737..1925145 | - | 409 | Protein_1786 | DUF5983 family protein | - |
QQ972_RS09220 (1926479) | 1926479..1926565 | - | 87 | Protein_1788 | DUF5983 family protein | - |
QQ972_RS09225 (1926562) | 1926562..1926948 | - | 387 | WP_042004473.1 | TA system toxin CbtA family protein | Toxin |
QQ972_RS09230 (1926995) | 1926995..1927369 | - | 375 | WP_001285482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QQ972_RS09235 (1927419) | 1927419..1928063 | - | 645 | WP_000086759.1 | hypothetical protein | - |
QQ972_RS09240 (1928081) | 1928081..1928302 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
QQ972_RS09245 (1928365) | 1928365..1928841 | - | 477 | WP_001186181.1 | RadC family protein | - |
QQ972_RS09250 (1928857) | 1928857..1929330 | - | 474 | WP_001313575.1 | antirestriction protein | - |
QQ972_RS09255 (1929424) | 1929424..1929669 | - | 246 | WP_001164966.1 | hypothetical protein | - |
QQ972_RS09260 (1929669) | 1929669..1930490 | - | 822 | WP_097752264.1 | DUF932 domain-containing protein | - |
QQ972_RS09265 (1930590) | 1930590..1930823 | - | 234 | WP_001213776.1 | DUF905 family protein | - |
QQ972_RS09270 (1930941) | 1930941..1931393 | - | 453 | WP_000682723.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14595.66 Da Isoelectric Point: 8.2918
>T283722 WP_042004473.1 NZ_CP127255:c1926948-1926562 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 387 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13791.44 Da Isoelectric Point: 4.7511
>AT283722 WP_001285482.1 NZ_CP127255:c1927369-1926995 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|