Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4695701..4696502 Replicon chromosome
Accession NZ_CP127252
Organism Escherichia coli strain C41

Toxin (Protein)


Gene name yeeV Uniprot ID A0A3W5RL53
Locus tag QQ971_RS22945 Protein ID WP_041124173.1
Coordinates 4696125..4696502 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3W5RLB4
Locus tag QQ971_RS22940 Protein ID WP_041124172.1
Coordinates 4695701..4696078 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ971_RS22905 (4691602) 4691602..4692282 + 681 WP_001282912.1 WYL domain-containing protein -
QQ971_RS22910 (4692433) 4692433..4693110 + 678 WP_021559490.1 hypothetical protein -
QQ971_RS22915 (4693116) 4693116..4693349 + 234 WP_001278287.1 DUF905 family protein -
QQ971_RS22920 (4693448) 4693448..4694266 + 819 WP_089599531.1 DUF932 domain-containing protein -
QQ971_RS22925 (4694358) 4694358..4694843 + 486 WP_041124170.1 antirestriction protein -
QQ971_RS22930 (4694859) 4694859..4695335 + 477 WP_021559500.1 RadC family protein -
QQ971_RS22935 (4695404) 4695404..4695625 + 222 WP_000692307.1 DUF987 domain-containing protein -
QQ971_RS22940 (4695701) 4695701..4696078 + 378 WP_041124172.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQ971_RS22945 (4696125) 4696125..4696502 + 378 WP_041124173.1 TA system toxin CbtA family protein Toxin
QQ971_RS22950 (4696499) 4696499..4696987 + 489 WP_041124174.1 DUF5983 family protein -
QQ971_RS22955 (4696999) 4696999..4697196 + 198 WP_000839249.1 DUF957 domain-containing protein -
QQ971_RS22960 (4697281) 4697281..4698126 + 846 WP_053289820.1 DUF4942 domain-containing protein -
QQ971_RS22965 (4698304) 4698304..4698813 + 510 WP_232949935.1 signal protein -
QQ971_RS22970 (4698905) 4698905..4699285 + 381 WP_001171554.1 transposase -
QQ971_RS22975 (4699282) 4699282..4699629 + 348 WP_000612589.1 IS66 family insertion sequence element accessory protein TnpB -
QQ971_RS22980 (4699679) 4699679..4701217 + 1539 WP_000998048.1 IS66-like element ISEc8 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4669753..4696502 26749


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13991.90 Da        Isoelectric Point: 7.3225

>T283709 WP_041124173.1 NZ_CP127252:4696125-4696502 [Escherichia coli]
MNTLPDTHVRETSGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13752.57 Da        Isoelectric Point: 6.2021

>AT283709 WP_041124172.1 NZ_CP127252:4695701-4696078 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3W5RL53

Antitoxin

Source ID Structure
AlphaFold DB A0A3W5RLB4

References