Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4543773..4544427 | Replicon | chromosome |
| Accession | NZ_CP127252 | ||
| Organism | Escherichia coli strain C41 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | QQ971_RS22210 | Protein ID | WP_286004742.1 |
| Coordinates | 4543773..4544180 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QQ971_RS22215 | Protein ID | WP_000354046.1 |
| Coordinates | 4544161..4544427 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ971_RS22190 (4539730) | 4539730..4541463 | - | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QQ971_RS22195 (4541469) | 4541469..4542179 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QQ971_RS22200 (4542204) | 4542204..4543100 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| QQ971_RS22205 (4543212) | 4543212..4543733 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QQ971_RS22210 (4543773) | 4543773..4544180 | - | 408 | WP_286004742.1 | protein YgfX | Toxin |
| QQ971_RS22215 (4544161) | 4544161..4544427 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QQ971_RS22220 (4544670) | 4544670..4545650 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| QQ971_RS22225 (4545846) | 4545846..4546505 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QQ971_RS22230 (4546669) | 4546669..4546980 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| QQ971_RS22235 (4547025) | 4547025..4548458 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| QQ971_RS22240 (4548515) | 4548515..4549258 | - | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16004.99 Da Isoelectric Point: 10.9373
>T283708 WP_286004742.1 NZ_CP127252:c4544180-4543773 [Escherichia coli]
VVLWQSDLRVSWLAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWLAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |