Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 101969..102705 | Replicon | plasmid pOXA10_130119 |
| Accession | NZ_CP127231 | ||
| Organism | Klebsiella pneumoniae strain 130119 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
| Locus tag | QRA14_RS28245 | Protein ID | WP_004187044.1 |
| Coordinates | 102223..102705 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | QRA14_RS28240 | Protein ID | WP_003026799.1 |
| Coordinates | 101969..102235 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRA14_RS28225 (QRA14_28230) | 97441..98835 | + | 1395 | WP_032439652.1 | cytosine permease | - |
| QRA14_RS28230 (QRA14_28235) | 98847..100055 | + | 1209 | WP_032448288.1 | imidazolonepropionase | - |
| QRA14_RS28235 (QRA14_28240) | 100048..100857 | + | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
| QRA14_RS28240 (QRA14_28245) | 101969..102235 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| QRA14_RS28245 (QRA14_28250) | 102223..102705 | + | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
| QRA14_RS28250 (QRA14_28255) | 102916..104262 | + | 1347 | WP_077251107.1 | ISNCY family transposase | - |
| QRA14_RS28255 (QRA14_28260) | 104422..105126 | + | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
| QRA14_RS28260 (QRA14_28265) | 105403..106749 | + | 1347 | WP_077254728.1 | ISNCY family transposase | - |
| QRA14_RS28265 (QRA14_28270) | 106798..107196 | + | 399 | WP_032422684.1 | helix-turn-helix domain-containing protein | - |
| QRA14_RS28270 (QRA14_28275) | 107344..107454 | - | 111 | Protein_107 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / blaLAP-2 / qnrS1 | iutA / iucD / iucC / iucB / iucA | 1..258228 | 258228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T283652 WP_004187044.1 NZ_CP127231:102223-102705 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|