Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 286559..287152 | Replicon | chromosome |
| Accession | NZ_CP127099 | ||
| Organism | Trueperella bernardiae strain UMB8254 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | QPC17_RS01325 | Protein ID | WP_285347385.1 |
| Coordinates | 286559..286840 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QPC17_RS01330 | Protein ID | WP_101923791.1 |
| Coordinates | 286853..287152 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPC17_RS01310 (QPC17_01310) | 283173..283709 | + | 537 | WP_148132171.1 | hypothetical protein | - |
| QPC17_RS01315 (QPC17_01315) | 284023..285915 | - | 1893 | WP_285347384.1 | cation-translocating P-type ATPase | - |
| QPC17_RS01320 (QPC17_01320) | 285912..286271 | - | 360 | WP_034662574.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| QPC17_RS01325 (QPC17_01325) | 286559..286840 | + | 282 | WP_285347385.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QPC17_RS01330 (QPC17_01330) | 286853..287152 | + | 300 | WP_101923791.1 | HigA family addiction module antitoxin | Antitoxin |
| QPC17_RS01335 (QPC17_01335) | 287328..287525 | - | 198 | WP_285347386.1 | hypothetical protein | - |
| QPC17_RS01340 (QPC17_01340) | 287739..288206 | + | 468 | WP_062613708.1 | GNAT family N-acetyltransferase | - |
| QPC17_RS01345 (QPC17_01345) | 288593..289051 | + | 459 | WP_285347387.1 | hypothetical protein | - |
| QPC17_RS01350 (QPC17_01350) | 289136..289729 | + | 594 | WP_070445877.1 | nitroreductase family protein | - |
| QPC17_RS01355 (QPC17_01355) | 289726..290523 | + | 798 | WP_062613686.1 | ATP-binding cassette domain-containing protein | - |
| QPC17_RS01360 (QPC17_01360) | 290520..291185 | + | 666 | WP_062613685.1 | ABC transporter permease subunit | - |
| QPC17_RS01365 (QPC17_01365) | 291169..291831 | + | 663 | WP_068538785.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10913.61 Da Isoelectric Point: 8.0114
>T283559 WP_285347385.1 NZ_CP127099:286559-286840 [Trueperella bernardiae]
VIISFADRDTEALYLRQPVRWLDFRLNRQALQKLRLLDSVVDLNELKIPPGNRLEALKGDRAGQFSIRINNQWQICFVWT
FMGPSELAIVDYH
VIISFADRDTEALYLRQPVRWLDFRLNRQALQKLRLLDSVVDLNELKIPPGNRLEALKGDRAGQFSIRINNQWQICFVWT
FMGPSELAIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|