Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 17120..17918 | Replicon | plasmid pEND_Eco 14033-3 |
| Accession | NZ_CP126951 | ||
| Organism | Escherichia coli O78:H4 strain APEC E14033 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | QQA23_RS25915 | Protein ID | WP_232602840.1 |
| Coordinates | 17397..17918 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A141BRA2 |
| Locus tag | QQA23_RS25910 | Protein ID | WP_001711191.1 |
| Coordinates | 17120..17389 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA23_RS25885 (QQA23_25885) | 12546..13886 | - | 1341 | WP_077136336.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| QQA23_RS25890 (QQA23_25890) | 13930..14670 | - | 741 | WP_021520120.1 | hypothetical protein | - |
| QQA23_RS25895 (QQA23_25895) | 14953..15720 | + | 768 | WP_000342417.1 | hypothetical protein | - |
| QQA23_RS25900 (QQA23_25900) | 15773..16126 | - | 354 | WP_160394000.1 | hypothetical protein | - |
| QQA23_RS25905 (QQA23_25905) | 16132..16800 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
| QQA23_RS25910 (QQA23_25910) | 17120..17389 | + | 270 | WP_001711191.1 | DUF1778 domain-containing protein | Antitoxin |
| QQA23_RS25915 (QQA23_25915) | 17397..17918 | + | 522 | WP_232602840.1 | GNAT family N-acetyltransferase | Toxin |
| QQA23_RS25920 (QQA23_25920) | 18086..18337 | - | 252 | WP_001404395.1 | hypothetical protein | - |
| QQA23_RS25925 (QQA23_25925) | 18339..19031 | - | 693 | WP_012640731.1 | hypothetical protein | - |
| QQA23_RS25930 (QQA23_25930) | 19045..19368 | - | 324 | WP_001717323.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..108542 | 108542 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19434.25 Da Isoelectric Point: 8.6369
>T283332 WP_232602840.1 NZ_CP126951:17397-17918 [Escherichia coli O78:H4]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLVNHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLIGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLVNHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLIGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|