Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelE-RHH |
| Location | 78260..78807 | Replicon | plasmid pEND_Eco 18005 |
| Accession | NZ_CP126947 | ||
| Organism | Escherichia coli O78:H51 strain APEC E18005 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QQA24_RS25260 | Protein ID | WP_097309154.1 |
| Coordinates | 78260..78538 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | E1QMW3 |
| Locus tag | QQA24_RS25265 | Protein ID | WP_000079941.1 |
| Coordinates | 78538..78807 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA24_RS25230 (74524) | 74524..74658 | - | 135 | WP_249531455.1 | hypothetical protein | - |
| QQA24_RS25235 (74618) | 74618..75559 | - | 942 | WP_001312841.1 | 3-deoxy-7-phosphoheptulonate synthase | - |
| QQA24_RS25240 (75740) | 75740..76040 | + | 301 | Protein_68 | hypothetical protein | - |
| QQA24_RS25245 (76118) | 76118..76465 | - | 348 | WP_000142437.1 | DUF6404 family protein | - |
| QQA24_RS25250 (76767) | 76767..77249 | - | 483 | WP_001311056.1 | hypothetical protein | - |
| QQA24_RS25255 (77366) | 77366..78214 | - | 849 | WP_001058005.1 | 3'-5' exonuclease | - |
| QQA24_RS25260 (78260) | 78260..78538 | - | 279 | WP_097309154.1 | type II toxin-antitoxin system toxin YacB | Toxin |
| QQA24_RS25265 (78538) | 78538..78807 | - | 270 | WP_000079941.1 | type II toxin-antitoxin system antitoxin YacA | Antitoxin |
| QQA24_RS25270 (79329) | 79329..80557 | + | 1229 | WP_112030635.1 | IS3-like element IS2 family transposase | - |
| QQA24_RS25275 (80754) | 80754..82028 | + | 1275 | WP_000489607.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / blaCTX-M-1 | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..204838 | 204838 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10799.42 Da Isoelectric Point: 8.4615
>T283294 WP_097309154.1 NZ_CP126947:c78538-78260 [Escherichia coli O78:H51]
MEIFWTMLASQDRKRIREYIAEQNLIAAIELDERIGYSASNLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTVQKWP
MEIFWTMLASQDRKRIREYIAEQNLIAAIELDERIGYSASNLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTVQKWP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|