Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4615347..4616181 | Replicon | chromosome |
| Accession | NZ_CP126944 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7MK10 |
| Locus tag | QQA28_RS22890 | Protein ID | WP_000854820.1 |
| Coordinates | 4615804..4616181 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | QQA28_RS22885 | Protein ID | WP_001285610.1 |
| Coordinates | 4615347..4615715 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS22845 (4611068) | 4611068..4611748 | + | 681 | WP_001278649.1 | WYL domain-containing protein | - |
| QQA28_RS22850 (4611899) | 4611899..4612576 | + | 678 | WP_001097565.1 | hypothetical protein | - |
| QQA28_RS22855 (4612582) | 4612582..4612815 | + | 234 | WP_000883181.1 | DUF905 family protein | - |
| QQA28_RS22860 (4612905) | 4612905..4613723 | + | 819 | WP_001175155.1 | DUF932 domain-containing protein | - |
| QQA28_RS22865 (4613749) | 4613749..4613889 | - | 141 | WP_000997937.1 | hypothetical protein | - |
| QQA28_RS22870 (4613989) | 4613989..4614468 | + | 480 | WP_000706978.1 | antirestriction protein | - |
| QQA28_RS22875 (4614483) | 4614483..4614959 | + | 477 | WP_001186193.1 | RadC family protein | - |
| QQA28_RS22880 (4615046) | 4615046..4615267 | + | 222 | WP_000692347.1 | DUF987 domain-containing protein | - |
| QQA28_RS22885 (4615347) | 4615347..4615715 | + | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQA28_RS22890 (4615804) | 4615804..4616181 | + | 378 | WP_000854820.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QQA28_RS22895 (4616178) | 4616178..4616375 | + | 198 | Protein_4488 | DUF5983 family protein | - |
| QQA28_RS22900 (4616403) | 4616403..4616600 | + | 198 | WP_085949158.1 | DUF957 domain-containing protein | - |
| QQA28_RS22905 (4616685) | 4616685..4617245 | + | 561 | Protein_4490 | DUF4942 domain-containing protein | - |
| QQA28_RS22910 (4618080) | 4618080..4619618 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14043.12 Da Isoelectric Point: 7.8839
>T283254 WP_000854820.1 NZ_CP126944:4615804-4616181 [Escherichia coli O1:K1:H7]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT283254 WP_001285610.1 NZ_CP126944:4615347-4615715 [Escherichia coli O1:K1:H7]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|