Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4559632..4560466 | Replicon | chromosome |
| Accession | NZ_CP126940 | ||
| Organism | Escherichia coli O2:K1:H7 strain APEC E18055 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7MK10 |
| Locus tag | QQA30_RS22600 | Protein ID | WP_000854820.1 |
| Coordinates | 4560089..4560466 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | QQA30_RS22595 | Protein ID | WP_001285610.1 |
| Coordinates | 4559632..4560000 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA30_RS22555 (4555353) | 4555353..4556033 | + | 681 | WP_001278649.1 | WYL domain-containing protein | - |
| QQA30_RS22560 (4556184) | 4556184..4556861 | + | 678 | WP_001097565.1 | hypothetical protein | - |
| QQA30_RS22565 (4556867) | 4556867..4557100 | + | 234 | WP_000883181.1 | DUF905 family protein | - |
| QQA30_RS22570 (4557190) | 4557190..4558008 | + | 819 | WP_001175155.1 | DUF932 domain-containing protein | - |
| QQA30_RS22575 (4558034) | 4558034..4558174 | - | 141 | WP_000997937.1 | hypothetical protein | - |
| QQA30_RS22580 (4558274) | 4558274..4558753 | + | 480 | WP_000706978.1 | antirestriction protein | - |
| QQA30_RS22585 (4558768) | 4558768..4559244 | + | 477 | WP_001186193.1 | RadC family protein | - |
| QQA30_RS22590 (4559331) | 4559331..4559552 | + | 222 | WP_000692347.1 | DUF987 domain-containing protein | - |
| QQA30_RS22595 (4559632) | 4559632..4560000 | + | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQA30_RS22600 (4560089) | 4560089..4560466 | + | 378 | WP_000854820.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QQA30_RS22605 (4560463) | 4560463..4560660 | + | 198 | Protein_4428 | DUF5983 family protein | - |
| QQA30_RS22610 (4560688) | 4560688..4560885 | + | 198 | WP_085949158.1 | DUF957 domain-containing protein | - |
| QQA30_RS22615 (4560970) | 4560970..4561530 | + | 561 | Protein_4430 | DUF4942 domain-containing protein | - |
| QQA30_RS22620 (4562365) | 4562365..4563903 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14043.12 Da Isoelectric Point: 7.8839
>T283185 WP_000854820.1 NZ_CP126940:4560089-4560466 [Escherichia coli O2:K1:H7]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT283185 WP_001285610.1 NZ_CP126940:4559632-4560000 [Escherichia coli O2:K1:H7]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|