Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 8762..9287 Replicon plasmid pHL21A
Accession NZ_CP126326
Organism Salmonella enterica subsp. enterica strain HL21

Toxin (Protein)


Gene name ccdB Uniprot ID I3VZQ7
Locus tag QN088_RS23410 Protein ID WP_001159874.1
Coordinates 8982..9287 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID -
Locus tag QN088_RS23405 Protein ID WP_079975208.1
Coordinates 8762..8980 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN088_RS23370 (QN088_23370) 3997..4404 + 408 WP_284546335.1 hypothetical protein -
QN088_RS23375 (QN088_23375) 4434..4940 + 507 WP_284546336.1 hypothetical protein -
QN088_RS23380 (QN088_23380) 5123..5320 + 198 Protein_5 transposase -
QN088_RS23385 (QN088_23385) 5340..6035 + 696 WP_079975203.1 aquaporin Z -
QN088_RS23390 (QN088_23390) 6374..6799 + 426 WP_284546337.1 hypothetical protein -
QN088_RS23395 (QN088_23395) 7375..7791 - 417 WP_284546338.1 type II toxin-antitoxin system VapC family toxin -
QN088_RS23400 (QN088_23400) 7788..8018 - 231 WP_008322219.1 type II toxin-antitoxin system VapB family antitoxin -
QN088_RS23405 (QN088_23405) 8762..8980 + 219 WP_079975208.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QN088_RS23410 (QN088_23410) 8982..9287 + 306 WP_001159874.1 type II toxin-antitoxin system toxin CcdB Toxin
QN088_RS23415 (QN088_23415) 9289..9579 + 291 WP_001266174.1 hypothetical protein -
QN088_RS23420 (QN088_23420) 9576..10076 + 501 WP_284546339.1 3'-5' exonuclease -
QN088_RS23425 (QN088_23425) 10264..10722 + 459 Protein_14 3'-5' exonuclease -
QN088_RS23430 (QN088_23430) 10757..11539 + 783 WP_015059761.1 site-specific integrase -
QN088_RS23435 (QN088_23435) 11682..12623 - 942 WP_000728920.1 Rpn family recombination-promoting nuclease/putative transposase -
QN088_RS23440 (QN088_23440) 12927..13175 - 249 WP_015059763.1 hypothetical protein -
QN088_RS23445 (QN088_23445) 13280..13570 - 291 WP_015059764.1 hypothetical protein -
QN088_RS23450 (QN088_23450) 13567..14193 - 627 WP_015059765.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..90249 90249


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11605.34 Da        Isoelectric Point: 5.6919

>T282786 WP_001159874.1 NZ_CP126326:8982-9287 [Salmonella enterica subsp. enterica]
MQFKVYTYKRESRYTLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8298.16 Da        Isoelectric Point: 4.5358

>AT282786 WP_079975208.1 NZ_CP126326:8762-8980 [Salmonella enterica subsp. enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTAMQNEARRLRAERWQEENREGMAEVASFIEANGSFADENRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A600Z065

Antitoxin

Source ID Structure

References