Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 869144..869804 | Replicon | chromosome |
Accession | NZ_CP126325 | ||
Organism | Salmonella enterica subsp. enterica strain HL21 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | QN088_RS04190 | Protein ID | WP_058116119.1 |
Coordinates | 869391..869804 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | QN088_RS04185 | Protein ID | WP_000351186.1 |
Coordinates | 869144..869410 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN088_RS04165 (865072) | 865072..866505 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
QN088_RS04170 (866664) | 866664..866975 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
QN088_RS04175 (867139) | 867139..867798 | + | 660 | WP_284546204.1 | hemolysin III family protein | - |
QN088_RS04180 (867914) | 867914..868894 | - | 981 | WP_023254245.1 | tRNA-modifying protein YgfZ | - |
QN088_RS04185 (869144) | 869144..869410 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
QN088_RS04190 (869391) | 869391..869804 | + | 414 | WP_058116119.1 | protein YgfX | Toxin |
QN088_RS04195 (869857) | 869857..870378 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
QN088_RS04200 (870491) | 870491..871387 | + | 897 | WP_000434299.1 | site-specific tyrosine recombinase XerD | - |
QN088_RS04205 (871411) | 871411..872124 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QN088_RS04210 (872130) | 872130..873863 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16298.29 Da Isoelectric Point: 11.1741
>T282767 WP_058116119.1 NZ_CP126325:869391-869804 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISRQH
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISRQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|