Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3378902..3379522 | Replicon | chromosome |
| Accession | NZ_CP126323 | ||
| Organism | Salmonella enterica subsp. enterica strain CY16 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | QN087_RS16280 | Protein ID | WP_001280991.1 |
| Coordinates | 3379304..3379522 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A6C6Z3Y6 |
| Locus tag | QN087_RS16275 | Protein ID | WP_000344806.1 |
| Coordinates | 3378902..3379276 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN087_RS16265 (3374041) | 3374041..3375234 | + | 1194 | WP_001039204.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QN087_RS16270 (3375257) | 3375257..3378406 | + | 3150 | WP_020976763.1 | efflux RND transporter permease AcrB | - |
| QN087_RS16275 (3378902) | 3378902..3379276 | + | 375 | WP_000344806.1 | Hha toxicity modulator TomB | Antitoxin |
| QN087_RS16280 (3379304) | 3379304..3379522 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| QN087_RS16285 (3379701) | 3379701..3380252 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| QN087_RS16290 (3380370) | 3380370..3380840 | + | 471 | Protein_3195 | YlaC family protein | - |
| QN087_RS16295 (3380896) | 3380896..3381036 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| QN087_RS16300 (3381038) | 3381038..3381304 | - | 267 | WP_020937098.1 | type B 50S ribosomal protein L31 | - |
| QN087_RS16305 (3381529) | 3381529..3383079 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| QN087_RS16315 (3383310) | 3383310..3383699 | + | 390 | WP_000961288.1 | MGMT family protein | - |
| QN087_RS16320 (3383732) | 3383732..3384301 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T282756 WP_001280991.1 NZ_CP126323:3379304-3379522 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14425.25 Da Isoelectric Point: 5.1444
>AT282756 WP_000344806.1 NZ_CP126323:3378902-3379276 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATKANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATKANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|