Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 196018..196778 | Replicon | chromosome |
| Accession | NZ_CP126323 | ||
| Organism | Salmonella enterica subsp. enterica strain CY16 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | Q57IH1 |
| Locus tag | QN087_RS00920 | Protein ID | WP_000533909.1 |
| Coordinates | 196293..196778 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | M7RHS4 |
| Locus tag | QN087_RS00915 | Protein ID | WP_000965886.1 |
| Coordinates | 196018..196305 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN087_RS00895 (191423) | 191423..192334 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
| QN087_RS00900 (192344) | 192344..194413 | + | 2070 | WP_001291748.1 | glycine--tRNA ligase subunit beta | - |
| QN087_RS00905 (194803) | 194803..195201 | + | 399 | Protein_179 | IS3 family transposase | - |
| QN087_RS00910 (195373) | 195373..195840 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
| QN087_RS00915 (196018) | 196018..196305 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
| QN087_RS00920 (196293) | 196293..196778 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
| QN087_RS00925 (197149) | 197149..197688 | - | 540 | WP_000047147.1 | copper-binding periplasmic metallochaperone CueP | - |
| QN087_RS00930 (197862) | 197862..198074 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| QN087_RS00935 (198362) | 198362..198652 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
| QN087_RS00940 (199091) | 199091..199801 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
| QN087_RS00945 (199851) | 199851..200813 | - | 963 | WP_000804673.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| QN087_RS00950 (201032) | 201032..201694 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T282745 WP_000533909.1 NZ_CP126323:196293-196778 [Salmonella enterica subsp. enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7F36 | |
| PDB | 7AK8 | |
| PDB | 5FVJ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK8 | |
| AlphaFold DB | A0A3V2JDX2 |