Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 4549856..4550378 Replicon chromosome
Accession NZ_CP126166
Organism Salmonella enterica subsp. enterica strain CRSE-01

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag NED09_RS22340 Protein ID WP_000220561.1
Coordinates 4549856..4550137 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NED09_RS22345 Protein ID WP_000121743.1
Coordinates 4550127..4550378 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NED09_RS22300 (4545838) 4545838..4546383 - 546 WP_000757692.1 DNA distortion polypeptide 1 -
NED09_RS22305 (4546709) 4546709..4546981 - 273 WP_000167280.1 hypothetical protein -
NED09_RS22310 (4547214) 4547214..4547393 - 180 WP_000439079.1 hypothetical protein -
NED09_RS22315 (4547436) 4547436..4547765 - 330 WP_000866654.1 hypothetical protein -
NED09_RS22320 (4547859) 4547859..4548101 - 243 WP_000008708.1 hypothetical protein -
NED09_RS22325 (4548091) 4548091..4548360 - 270 WP_001006718.1 hypothetical protein -
NED09_RS22330 (4548369) 4548369..4548917 - 549 WP_001178641.1 hypothetical protein -
NED09_RS22335 (4548991) 4548991..4549506 - 516 WP_001025387.1 J domain-containing protein -
NED09_RS22340 (4549856) 4549856..4550137 - 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NED09_RS22345 (4550127) 4550127..4550378 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NED09_RS22350 (4551399) 4551399..4552268 + 870 WP_001212191.1 replication initiation protein -
NED09_RS22355 (4552273) 4552273..4553124 + 852 WP_000435059.1 replication initiation protein -
NED09_RS22360 (4553128) 4553128..4553574 + 447 WP_001074378.1 hypothetical protein -
NED09_RS22365 (4553711) 4553711..4554064 + 354 WP_024156393.1 DNA distortion polypeptide 3 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaTEM-1B / aph(6)-Id / aph(3'')-Ib / tet(A) / sul2 sseI/srfH 4537790..4587592 49802


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T282720 WP_000220561.1 NZ_CP126166:c4550137-4549856 [Salmonella enterica subsp. enterica]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT282720 WP_000121743.1 NZ_CP126166:c4550378-4550127 [Salmonella enterica subsp. enterica]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References