Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 4093268..4093493 Replicon chromosome
Accession NZ_CP126166
Organism Salmonella enterica subsp. enterica strain CRSE-01

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag NED09_RS19805 Protein ID WP_000813254.1
Coordinates 4093268..4093423 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 4093435..4093493 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NED09_RS19770 4088375..4088656 - 282 WP_000445513.1 phage holin family protein -
NED09_RS19775 4088646..4088834 - 189 WP_001688615.1 putative holin -
NED09_RS19780 4088828..4089151 - 324 Protein_3846 tellurite/colicin resistance protein -
NED09_RS19785 4091322..4091858 - 537 WP_000640113.1 DUF1133 family protein -
NED09_RS19790 4091855..4092145 - 291 WP_000774470.1 DUF1364 domain-containing protein -
NED09_RS19795 4092145..4092744 - 600 WP_000940751.1 DUF1367 family protein -
NED09_RS19800 4092807..4092977 - 171 WP_000734094.1 hypothetical protein -
NED09_RS19805 4093268..4093423 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 4093435..4093493 + 59 - - Antitoxin
NED09_RS19810 4093850..4094782 + 933 WP_079902810.1 hypothetical protein -
NED09_RS19815 4094779..4095333 + 555 WP_001033796.1 hypothetical protein -
NED09_RS19820 4095495..4095824 - 330 WP_001676916.1 DUF977 family protein -
NED09_RS19825 4095868..4095915 - 48 Protein_3855 hypothetical protein -
NED09_RS19830 4096097..4096564 + 468 WP_001227859.1 helix-turn-helix domain-containing protein -
NED09_RS19835 4096949..4097104 + 156 WP_085981757.1 DUF1391 family protein -
NED09_RS19840 4097212..4097733 - 522 WP_000004762.1 super-infection exclusion protein B -
NED09_RS19845 4098171..4098392 + 222 WP_000560208.1 cell division protein FtsZ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4087833..4099704 11871


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T282715 WP_000813254.1 NZ_CP126166:c4093423-4093268 [Salmonella enterica subsp. enterica]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT282715 NZ_CP126166:4093435-4093493 [Salmonella enterica subsp. enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References