Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2447227..2447887 | Replicon | chromosome |
| Accession | NZ_CP126166 | ||
| Organism | Salmonella enterica subsp. enterica strain CRSE-01 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | NED09_RS11745 | Protein ID | WP_000244756.1 |
| Coordinates | 2447474..2447887 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | NED09_RS11740 | Protein ID | WP_000351186.1 |
| Coordinates | 2447227..2447493 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NED09_RS11720 (2443156) | 2443156..2444589 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
| NED09_RS11725 (2444747) | 2444747..2445058 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| NED09_RS11730 (2445222) | 2445222..2445881 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| NED09_RS11735 (2445997) | 2445997..2446977 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
| NED09_RS11740 (2447227) | 2447227..2447493 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| NED09_RS11745 (2447474) | 2447474..2447887 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
| NED09_RS11750 (2447940) | 2447940..2448461 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| NED09_RS11755 (2448574) | 2448574..2449470 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| NED09_RS11760 (2449494) | 2449494..2450207 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NED09_RS11765 (2450213) | 2450213..2451946 | + | 1734 | WP_000813389.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T282712 WP_000244756.1 NZ_CP126166:2447474-2447887 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |